LGI1 (NM_005097) Human Tagged ORF Clone

CAT#: RC205340

Reviews ()
Write a review

LGI1 (Myc-DDK-tagged)-Human leucine-rich, glioma inactivated 1 (LGI1)



Reconstitution Protocol

USD 519.00

In Stock*

Size
    • 10 ug

Product images

Other products for "LGI1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LGI1
Synonyms ADLTE; ADPAEF; ADPEAF; EPITEMPIN; EPT; ETL1; IB1099
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205340 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAATCAGAAAGAAGCAAAAGGATGGGAAATGCCTGCATTCCCCTGAAAAGAATTGCTTATTTCCTAT
GTCTCTTATCTGCGCTTTTGCTGACTGAGGGGAAGAAACCAGCGAAGCCAAAATGCCCTGCCGTGTGTAC
TTGTACCAAAGATAATGCTTTATGTGAGAATGCCAGATCCATTCCACGCACCGTTCCTCCTGATGTTATC
TCATTATCCTTTGTGAGATCTGGTTTTACTGAAATCTCAGAAGGGAGTTTTTTATTCACGCCATCGCTGC
AGCTCTTGTTATTCACATCGAACTCCTTTGATGTGATCAGTGATGATGCTTTTATTGGTCTTCCACATCT
AGAGTATTTATTCATAGAAAACAACAACATCAAGTCAATTTCAAGACATACTTTCCGGGGACTAAAGTCA
TTAATTCACTTGAGCCTTGCAAACAACAATCTCCAGACACTCCCAAAAGATATTTTCAAAGGCCTGGATT
CTTTAACAAATGTGGACCTGAGGGGTAATTCATTTAATTGTGACTGTAAACTGAAATGGCTAGTGGAATG
GCTTGGCCACACCAATGCAACTGTTGAAGACATCTACTGCGAAGGCCCCCCAGAATACAAGAAGCGCAAA
ATCAATAGTCTCTCCTCGAAGGATTTCGATTGCATCATTACAGAATTTGCAAAGTCTCAAGACCTGCCTT
ATCAATCATTGTCCATAGACACTTTTTCTTATTTGAATGATGAGTATGTAGTCATCGCTCAGCCTTTTAC
TGGAAAATGCATTTTCCTTGAATGGGACCATGTGGAAAAGACCTTCCGGAATTATGACAACATTACAGGC
ACATCCACTGTAGTATGCAAGCCTATAGTCATTGAAACTCAGCTCTATGTTATTGTGGCCCAGCTGTTTG
GTGGCTCTCACATCTATAAGCGAGACAGTTTTGCAAATAAATTCATAAAAATCCAGGATATTGAAATTCT
CAAAATCCGAAAACCCAATGACATTGAAACATTCAAGATTGAAAACAACTGGTACTTTGTTGTTGCTGAC
AGTTCAAAAGCTGGTTTTACTACCATTTACAAATGGAACGGAAACGGATTCTACTCCCATCAATCCTTAC
ACGCGTGGTACAGGGACACTGATGTGGAATATCTAGAAATAGTCAGAACACCTCAGACACTCAGAACGCC
TCATTTAATTCTGTCTAGTAGTTCCCAGCGTCCTGTAATTTATCAGTGGAACAAAGCAACACAATTATTC
ACTAACCAAACTGACATTCCTAACATGGAGGATGTGTACGCAGTGAAGCACTTCTCAGTGAAAGGGGACG
TGTACATTTGCTTGACAAGATTCATTGGTGATTCCAAAGTCATGAAATGGGGAGGCTCCTCGTTCCAGGA
TATTCAGAGGATGCCATCGCGAGGATCCATGGTGTTCCAGCCTCTTCAAATAAATAATTACCAATATGCA
ATTCTTGGAAGTGATTACTCCTTTACTCAAGTGTATAACTGGGATGCAGAGAAAGCCAAATTTGTGAAAT
TTCAGGAATTAAATGTTCAGGCACCAAGATCATTCACACATGTGTCCATTAATAAGCGTAATTTTCTTTT
TGCTTCCAGTTTTAAGGGAAATACACAGATTTACAAACATGTCATAGTTGACTTAAGCGCA


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC205340 protein sequence
Red=Cloning site Green=Tags(s)

MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVI
SLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKS
LIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRK
INSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITG
TSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVAD
SSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLF
TNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYA
ILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005097
ORF Size 1671 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005097.3
RefSeq Size 2366 bp
RefSeq ORF 1674 bp
Locus ID 9211
UniProt ID O95970
Cytogenetics 10q23.33
Domains LRRCT, LRR, LRR_TYP, EPTP
Protein Families Druggable Genome, Secreted Protein
MW 63.8 kDa
Gene Summary This gene encodes a member of the secreted leucine-rich repeat (LRR) superfamily and shares homology with members of the SLIT protein family. The encoded protein may regulate the activity of voltage-gated potassium channels and may be involved in neuronal growth regulation and cell survival. This gene is rearranged as a result of translocations in glioblastoma cell lines, and it is frequently down-regulated or rearranged in malignant gliomas. Mutations in this gene result in autosomal dominant lateral temporal epilepsy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.