PI 3 Kinase Class 3 (PIK3C3) (NM_002647) Human Tagged ORF Clone

CAT#: RC205317

Reviews ()
Write a review

PIK3C3 (Myc-DDK-tagged)-Human phosphoinositide-3-kinase, class 3 (PIK3C3)



  "NM_002647" in other vectors (6)

Reconstitution Protocol

USD 812.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PIK3C3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PIK3C3
Synonyms hVps34; VPS34; Vps34
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205317 representing NM_002647
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGAAGCAGAGAAGTTTCACTACATCTATAGTTGTGACCTGGATATCAACGTCCAGCTTAAGATAG
GAAGCTTGGAAGGGAAGAGAGAACAAAAGAGTTATAAAGCTGTCCTGGAAGACCCAATGTTGAAGTTCTC
AGGACTATATCAAGAGACATGCTCTGATCTTTATGTTACTTGTCAAGTTTTTGCAGAAGGGAAGCCTTTG
GCCTTGCCAGTGAGAACATCCTACAAAGCATTTAGTACAAGATGGAACTGGAATGAATGGCTGAAACTAC
CAGTAAAATACCCTGACCTGCCCAGGAATGCCCAAGTGGCCCTCACCATATGGGATGTGTATGGTCCCGG
AAAAGCAGTGCCTGTAGGAGGAACAACGGTTTCGCTCTTTGGAAAATACGGCATGTTTCGCCAAGGGATG
CATGACTTGAAAGTCTGGCCTAATGTAGAAGCAGATGGATCAGAACCCACAAAAACTCCTGGCAGAACAA
GTAGCACTCTCTCAGAAGATCAGATGAGCCGTCTTGCCAAGCTCACCAAAGCTCATCGACAAGGACACAT
GGTGAAAGTAGATTGGCTGGATAGATTGACATTTAGAGAAATAGAAATGATAAATGAGAGTGAAAAACGA
AGTTCTAATTTCATGTACCTGATGGTTGAATTTCGATGTGTCAAGTGTGATGATAAGGAATATGGTATTG
TTTATTATGAAAAGGACGGTGATGAATCATCTCCAATTTTAACAAGTTTTGAATTAGTGAAAGTTCCTGA
CCCCCAGATGTCTATGGAGAATTTAGTTGAGAGCAAACACCACAAGCTTGCCCGGAGTTTAAGAAGTGGA
CCTTCTGACCACGATCTGAAACCCAATGCTGCCACGAGAGATCAGTTAAATATTATTGTGAGTTATCCAC
CAACCAAGCAACTTACATATGAAGAACAAGATCTTGTTTGGAAGTTTAGATATTATCTTACGAATCAAGA
AAAAGCCTTGACAAAATTCTTGAAATGTGTTAATTGGGATCTACCTCAAGAGGCCAAACAGGCCTTGGAA
CTTCTGGGAAAATGGAAGCCGATGGATGTAGAGGACTCCTTGGAGCTGTTATCCTCTCATTACACCAACC
CAACTGTGAGGCGTTATGCTGTTGCCCGGTTGCGACAGGCCGATGATGAGGATTTGTTGATGTACCTATT
ACAATTGGTCCAGGCTCTCAAATATGAAAATTTTGATGATATAAAGAATGGATTGGAACCTACCAAGAAG
GATAGTCAGAGTTCAGTGTCAGAAAATGTGTCAAATTCTGGAATAAATTCTGCAGAAATAGATAGCTCCC
AAATTATAACCAGCCCCCTTCCTTCAGTCTCTTCACCTCCTCCTGCATCAAAAACAAAAGAAGTTCCAGA
TGGCGAAAATCTGGAACAAGATCTCTGTACCTTCTTGATATCGAGAGCCTGCAAAAACTCAACACTGGCT
AATTATTTATACTGGTATGTGATAGTGGAATGTGAAGATCAAGATACTCAGCAGAGAGATCCAAAGACCC
ATGAGATGTACTTGAACGTAATGAGAAGATTCAGCCAAGCATTGTTGAAGGGTGATAAGTCTGTCAGAGT
TATGCGTTCTTTGCTGGCTGCACAACAGACATTTGTAGATCGGTTGGTGCATCTAATGAAGGCAGTACAA
CGCGAAAGTGGAAATCGTAAGAAAAAGAATGAGAGACTACAGGCATTGCTTGGAGATAATGAAAAGATGA
ATTTGTCAGATGTGGAACTTATCCCGTTGCCTTTAGAACCCCAAGTGAAAATTAGAGGAATAATTCCGGA
AACAGCTACACTGTTTAAAAGTGCCCTTATGCCTGCACAGTTGTTTTTTAAGACGGAAGATGGAGGCAAA
TATCCAGTTATATTTAAGCATGGAGATGATTTACGTCAAGATCAACTTATTCTTCAAATCATTTCACTCA
TGGACAAGCTGTTACGGAAAGAAAATCTGGACTTGAAATTGACACCTTATAAGGTGTTAGCCACCAGTAC
AAAACATGGCTTCATGCAGTTTATCCAGTCAGTTCCTGTGGCTGAAGTTCTTGATACAGAGGGAAGCATT
CAGAACTTTTTTAGAAAATATGCACCAAGTGAGAATGGGCCAAATGGGATTAGTGCTGAGGTCATGGACA
CTTACGTTAAAAGCTGTGCTGGATATTGCGTGATCACCTATATACTTGGAGTTGGAGACAGGCACCTGGA
TAACCTTTTGCTAACAAAAACAGGCAAACTCTTCCACATAGACTTTGGATATATTTTGGGTCGGGATCCA
AAGCCTCTTCCTCCACCAATGAAGCTGAATAAAGAAATGGTAGAAGGAATGGGGGGCACACAGAGTGAGC
AGTACCAAGAGTTCCGTAAACAGTGTTACACGGCTTTCCTCCACCTGCGAAGGTATTCTAATCTGATTTT
GAACTTGTTTTCCTTGATGGTTGATGCAAACATTCCAGATATTGCACTTGAACCAGATAAAACTGTGAAA
AAGGTTCAGGATAAATTCCGCTTAGACCTGTCGGATGAAGAGGCTGTGCATTACATGCAGAGTCTGATTG
ATGAGAGTGTCCATGCTCTTTTTGCTGCAGTGGTGGAACAGATTCACAAGTTTGCCCAGTACTGGAGAAA
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205317 representing NM_002647
Red=Cloning site Green=Tags(s)

MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPL
ALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGM
HDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKR
SSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSG
PSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALE
LLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLA
NYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQ
RESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGK
YPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSI
QNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDP
KPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002647
ORF Size 2661 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002647.4
RefSeq Size 3083 bp
RefSeq ORF 2664 bp
Locus ID 5289
UniProt ID Q8NEB9
Cytogenetics 18q12.3
Domains PI3_PI4_kinase, PI3Ka, PI3K_C2
Protein Families Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system, Regulation of autophagy
MW 101.4 kDa
Gene Summary Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate; different complex forms are believed to play a role in multiple membrane trafficking pathways: PI3KC3-C1 is involved in initiation of autophagosomes and PI3KC3-C2 in maturation of autophagosomes and endocytosis. Involved in regulation of degradative endocytic trafficking and required for the abcission step in cytokinesis, probably in the context of PI3KC3-C2 (PubMed:20643123, PubMed:20208530). Involved in the transport of lysosomal enzyme precursors to lysosomes. Required for transport from early to late endosomes (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.