CH25H (NM_003956) Human Tagged ORF Clone

CAT#: RC204716

CH25H (Myc-DDK-tagged)-Human cholesterol 25-hydroxylase (CH25H)

Change vector?

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CH25H (NM_003956) Human Tagged ORF Clone
Symbol CH25H
Synonyms C25H
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC204716 representing NM_003956
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTGCCACAACTGCTCCGACCCCCAGGTCCTTTGCAGCTCCGGGCAGCTGTTCCTGCAGCCCCTCT
GGGACCACCTGAGGAGCTGGGAGGCCCTCCTACAGTCGCCCTTCTTCCCGGTCATCTTCTCCATCACCAC
ATACGTGGGCTTTTGCCTGCCCTTCGTGGTCCTGGATATCCTGTGCTCCTGGGTGCCCGCCCTGCGGCGC
TACAAGATCCACCCTGACTTCTCGCCATCCGCGCAGCAGCTGCTACCTTGCCTGGGGCAGACCCTCTACC
AGCATGTGATGTTTGTGTTCCCCGTGACGCTGCTGCATTGGGCCCGCAGCCCGGCCCTCCTGCCCCACGA
AGCTCCCGAGCTGCTCCTGCTGCTGCACCACATCCTGTTCTGCCTGCTACTCTTCGACATGGAGTTCTTC
GTGTGGCACCTGCTGCACCACAAGGTGCCCTGGCTGTACCGCACCTTCCACAAGGTGCACCACCAGAACT
CGTCCTCGTTCGCGCTGGCAACGCAGTATATGAGCGTCTGGGAACTGTTTTCTTTGGGCTTCTTCGACAT
GATGAACGTCACACTGCTCGGGTGCCACCCGCTCACCACCCTGACCTTCCACGTGGTCAACATCTGGCTT
TCCGTGGAGGACCACTCCGGCTACAACTTCCCTTGGTCCACTCACAGACTGGTGCCCTTCGGGTGGTACG
GGGGTGTGGTGCACCACGACCTGCATCACTCTCACTTTAACTGCAACTTCGCTCCGTACTTTACACACTG
GGACAAAATACTGGGAACGCTGCGGACTGCATCTGTCCCAGCGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204716 representing NM_003956
Red=Cloning site Green=Tags(s)

MSCHNCSDPQVLCSSGQLFLQPLWDHLRSWEALLQSPFFPVIFSITTYVGFCLPFVVLDILCSWVPALRR
YKIHPDFSPSAQQLLPCLGQTLYQHVMFVFPVTLLHWARSPALLPHEAPELLLLLHHILFCLLLFDMEFF
VWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSVWELFSLGFFDMMNVTLLGCHPLTTLTFHVVNIWL
SVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLRTASVPAR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003956
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003956.1, NM_003956.2, NM_003956.3, NP_003947
RefSeq Size 1411
RefSeq ORF 819
Locus ID 9023
Cytogenetics 10q23.31
Protein Families Transmembrane
Protein Pathways Primary bile acid biosynthesis
MW 31.6 kDa
Gene Summary This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations