Fibroblast activation protein, alpha(FAP) (NM_004460) Human Tagged ORF Clone

CAT#: RC204692

FAP (Myc-DDK-tagged)-Human fibroblast activation protein, alpha (FAP)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Fibroblast activation protein, alpha(FAP) (NM_004460) Human Tagged ORF Clone
Symbol FAP
Synonyms DPPIV; FAPA; SIMP
Vector pCMV6-Entry
Sequence Data
>RC204692 representing NM_004460
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACTTGGGTAAAAATCGTATTTGGAGTTGCCACCTCTGCTGTGCTTGCCTTATTGGTGATGTGCA
TTGTCTTACGCCCTTCAAGAGTTCATAACTCTGAAGAAAATACAATGAGAGCACTCACACTGAAGGATAT
TTTAAATGGAACATTTTCTTATAAAACATTTTTTCCAAACTGGATTTCAGGACAAGAATATCTTCATCAA
TCTGCAGATAACAATATAGTACTTTATAATATTGAAACAGGACAATCATATACCATTTTGAGTAATAGAA
CCATGAAAAGTGTGAATGCTTCAAATTACGGCTTATCACCTGATCGGCAATTTGTATATCTAGAAAGTGA
TTATTCAAAGCTTTGGAGATACTCTTACACAGCAACATATTACATCTATGACCTTAGCAATGGAGAATTT
GTAAGAGGAAATGAGCTTCCTCGTCCAATTCAGTATTTATGCTGGTCGCCTGTTGGGAGTAAATTAGCAT
ATGTCTATCAAAACAATATCTATTTGAAACAAAGACCAGGAGATCCACCTTTTCAAATAACATTTAATGG
AAGAGAAAATAAAATATTTAATGGAATCCCAGACTGGGTTTATGAAGAGGAAATGCTTGCTACAAAATAT
GCTCTCTGGTGGTCTCCTAATGGAAAATTTTTGGCATATGCGGAATTTAATGATACGGATATACCAGTTA
TTGCCTATTCCTATTATGGCGATGAACAATATCCTAGAACAATAAATATTCCATACCCAAAGGCTGGAGC
TAAGAATCCCGTTGTTCGGATATTTATTATCGATACCACTTACCCTGCGTATGTAGGTCCCCAGGAAGTG
CCTGTTCCAGCAATGATAGCCTCAAGTGATTATTATTTCAGTTGGCTCACGTGGGTTACTGATGAACGAG
TATGTTTGCAGTGGCTAAAAAGAGTCCAGAATGTTTCGGTCCTGTCTATATGTGACTTCAGGGAAGACTG
GCAGACATGGGATTGTCCAAAGACCCAGGAGCATATAGAAGAAAGCAGAACTGGATGGGCTGGTGGATTC
TTTGTTTCAACACCAGTTTTCAGCTATGATGCCATTTCGTACTACAAAATATTTAGTGACAAGGATGGCT
ACAAACATATTCACTATATCAAAGACACTGTGGAAAATGCTATTCAAATTACAAGTGGCAAGTGGGAGGC
CATAAATATATTCAGAGTAACACAGGATTCACTGTTTTATTCTAGCAATGAATTTGAAGAATACCCTGGA
AGAAGAAACATCTACAGAATTAGCATTGGAAGCTATCCTCCAAGCAAGAAGTGTGTTACTTGCCATCTAA
GGAAAGAAAGGTGCCAATATTACACAGCAAGTTTCAGCGACTACGCCAAGTACTATGCACTTGTCTGCTA
CGGCCCAGGCATCCCCATTTCCACCCTTCATGATGGACGCACTGATCAAGAAATTAAAATCCTGGAAGAA
AACAAGGAATTGGAAAATGCTTTGAAAAATATCCAGCTGCCTAAAGAGGAAATTAAGAAACTTGAAGTAG
ATGAAATTACTTTATGGTACAAGATGATTCTTCCTCCTCAATTTGACAGATCAAAGAAGTATCCCTTGCT
AATTCAAGTGTATGGTGGTCCCTGCAGTCAGAGTGTAAGGTCTGTATTTGCTGTTAATTGGATATCTTAT
CTTGCAAGTAAGGAAGGGATGGTCATTGCCTTGGTGGATGGTCGAGGAACAGCTTTCCAAGGTGACAAAC
TCCTCTATGCAGTGTATCGAAAGCTGGGTGTTTATGAAGTTGAAGACCAGATTACAGCTGTCAGAAAATT
CATAGAAATGGGTTTCATTGATGAAAAAAGAATAGCCATATGGGGCTGGTCCTATGGAGGATACGTTTCA
TCACTGGCCCTTGCATCTGGAACTGGTCTTTTCAAATGTGGTATAGCAGTGGCTCCAGTCTCCAGCTGGG
AATATTACGCGTCTGTCTACACAGAGAGATTCATGGGTCTCCCAACAAAGGATGATAATCTTGAGCACTA
TAAGAATTCAACTGTGATGGCAAGAGCAGAATATTTCAGAAATGTAGACTATCTTCTCATCCACGGAACA
GCAGATGATAATGTGCACTTTCAAAACTCAGCACAGATTGCTAAAGCTCTGGTTAATGCACAAGTGGATT
TCCAGGCAATGTGGTACTCTGACCAGAACCACGGCTTATCCGGCCTGTCCACGAACCACTTATACACCCA
CATGACCCACTTCCTAAAGCAGTGTTTCTCTTTGTCAGAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC204692 representing NM_004460
Red=Cloning site Green=Tags(s)

MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQ
SADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEF
VRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKY
ALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV
PVPAMIASSDYYFSWLTWVTDERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGF
FVSTPVFSYDAISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGRTDQEIKILEE
NKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISY
LASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVS
SLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGT
ADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004460
ORF Size 2280 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004460.1, NM_004460.2, NM_004460.3, NM_004460.4, NP_004451
RefSeq Size 2788
RefSeq ORF 2283
Locus ID 2191
Cytogenetics 2q24.2
Domains Peptidase_S9, DPPIV_N_term
Protein Families Transmembrane, Protease, Druggable Genome
MW 87.5 kDa
Gene Summary The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)