MED28 (NM_025205) Human Tagged ORF Clone

CAT#: RC204304

MED28 (Myc-DDK-tagged)-Human mediator complex subunit 28 (MED28)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_025205" in other vectors (5)

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


MED28 mouse monoclonal antibody,clone OTI10C8
    • 100 ul

USD 447.00

Other products for "MED28"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MED28
Synonyms 1500003D12Rik; EG1; magicin
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC204304 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTCCACTAGGGGGTATGTTTTCTGGGCAGCCACCCGGTCCCCCTCAGGCCCCGCCGGGCCTTC
CGGGCCAAGCTTCGCTTCTTCAGGCAGCTCCAGGCGCTCCTAGACCTTCCAGCAGTACTTTGGTGGACGA
GTTGGAGTCATCTTTCGAGGCTTGCTTTGCATCTCTGGTGAGTCAGGACTATGTCAATGGCACCGATCAG
GAAGAAATTCGAACCGGTGTTGATCAGTGTATCCAGAAGTTTCTGGATATTGCAAGACAGACAGAATGTT
TTTTCTTACAAAAAAGATTGCAGTTATCTGTCCAGAAACCAGAGCAAGTTATCAAAGAGGATGTGTCAGA
ACTAAGGAATGAATTACAGCGGAAAGATGCACTAGTCCAGAAGCACTTGACAAAGCTGAGGCATTGGCAG
CAGGTGCTGGAGGACATCAACGTGCAGCACAAAAAGCCCGCCGACATCCCTCAGGGCTCCTTGGCCTACC
TGGAGCAGGCATCTGCCAACATCCCTGCACCTCTGAAGCCAACG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC204304 protein sequence
Red=Cloning site Green=Tags(s)

MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQ
EEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQ
QVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025205
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025205.5
RefSeq Size 1363 bp
RefSeq ORF 537 bp
Locus ID 80306
UniProt ID Q9H204
Cytogenetics 4p15.32
Protein Families Transcription Factors
MW 19.5 kDa
Gene Summary Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May be part of a complex containing NF2/merlin that participates in cellular signaling to the actin cytoskeleton downstream of tyrosine kinase signaling pathways.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.