N acetyl transferase 5(NAA20) (NM_016100) Human Tagged ORF Clone

CAT#: RC203305

NAA20 (Myc-DDK-tagged)-Human N(alpha)-acetyltransferase 20, NatB catalytic subunit (NAA20), transcript variant 1

  View "NM_016100" in other vectors (10)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name N acetyl transferase 5(NAA20) (NM_016100) Human Tagged ORF Clone
Symbol NAA20
Synonyms dJ1002M8.1; NAT3; NAT3P; NAT5; NAT5P
Vector pCMV6-Entry
Sequence Data
>RC203305 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCACGCTACGGGCCTTTACCTGCGACGACCTGTTCCGCTTCAACAACATTAACTTGGATCCACTTA
CAGAAACTTATGGGATTCCTTTCTACCTACAATACCTCGCCCACTGGCCAGAGTATTTCATTGTTGCAGA
GGCACCTGGTGGAGAATTAATGGGTTATATTATGGGTAAAGCAGAAGGCTCAGTAGCTAGGGAAGAATGG
CACGGGCACGTCACAGCTCTGTCTGTTGCCCCAGAATTTCGACGCCTTGGTTTGGCTGCTAAACTTATGG
AGTTACTAGAGGAGATTTCAGAAAGAAAGGGTGGATTTTTTGTGGATCTCTTTGTAAGAGTATCTAACCA
AGTTGCAGTTAACATGTACAAGCAGTTGGGCTACAGTGTATATAGGACGGTCATAGAGTACTATTCGGCC
AGCAACGGGGAGCCTGATGAGGACGCTTATGATATGAGGAAAGCACTTTCCAGGGATACTGAGAAGAAAT
CCATCATACCATTACCTCATCCTGTGAGGCCTGAAGACATTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203305 protein sequence
Red=Cloning site Green=Tags(s)

MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEW
HGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSA
SNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016100
ORF Size 537 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016100.1, NM_016100.2, NM_016100.3, NM_016100.4, NP_057184
RefSeq Size 1102
RefSeq ORF 537
Locus ID 51126
Cytogenetics 20p11.23
Domains Acetyltransf
Protein Pathways Tyrosine metabolism, Phenylalanine metabolism, Glycerophospholipid metabolism, Limonene and pinene degradation
MW 20.4 kDa
Gene Summary NAT5 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIM, Apr 2009]

Other Versions

Other products for "NAA20"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones