SRP14 (NM_003134) Human Tagged ORF Clone
CAT#: RC203212
SRP14 (Myc-DDK-tagged)-Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_003134" in other vectors (6)
Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | SRP14 |
Synonyms | ALURBP |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203212 representing NM_003134
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGTTGTTGGAGAGCGAGCAGTTCCTGACGGAGCTGACCAGACTTTTCCAGAAGTGCCGGACGTCGG GCAGCGTCTATATCACCTTGAAGAAGTATGACGGTCGAACCAAACCCATTCCAAAGAAGGGTACTGTGGA GGGCTTTGAGCCCGCAGACAACAAGTGTCTGTTAAGAGCTACCGATGGGAAGAAGAAGATCAGCACTGTG GTGAGCTCCAAGGAAGTGAATAAGTTTCAGATGGCTTATTCAAACCTCCTTAGAGCTAACATGGATGGGC TGAAGAAGAGAGACAAAAAGAACAAAACTAAGAAGACCAAAGCAGCAGCAGCAGCAGCAGCAGCAGCACC TGCCGCAGCAGCAACAGCACCAACAACAGCAGCAACAACAGCAGCAACAGCAGCACAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203212 representing NM_003134
Red=Cloning site Green=Tags(s) MVLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTV VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAAPAAAATAPTTAATTAATAAQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_003134 |
ORF Size | 408 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_003134.6 |
RefSeq Size | 800 bp |
RefSeq ORF | 411 bp |
Locus ID | 6727 |
UniProt ID | P37108 |
Cytogenetics | 15q15.1 |
Domains | SRP14 |
Protein Pathways | Protein export |
MW | 14.4 kDa |
Gene Summary | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203212L1 | Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), Myc-DDK-tagged |
USD 525.00 |
|
RC203212L2 | Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), mGFP tagged |
USD 525.00 |
|
RC203212L3 | Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), Myc-DDK-tagged |
USD 525.00 |
|
RC203212L4 | Lenti ORF clone of Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14), mGFP tagged |
USD 525.00 |
|
RG203212 | SRP14 (tGFP-tagged) - Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) |
USD 425.00 |
|
SC118180 | SRP14 (untagged)-Human signal recognition particle 14kDa (homologous Alu RNA binding protein) (SRP14) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review