p60 CAF1 (CHAF1B) (NM_005441) Human Tagged ORF Clone

CAT#: RC202858

Reviews ()
Write a review

CHAF1B (Myc-DDK-tagged)-Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)



  "NM_005441" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CHAF1B
Synonyms CAF-1; CAF-IP60; CAF1; CAF1A; CAF1P60; MPHOSPH7; MPP7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202858 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGTCATCACTTGTGAAATAGCCTGGCACAACAAGGAGCCCGTGTACAGCCTGGACTTCCAGCATG
GGACGGCTGGGAGGATCCACAGACTGGCGTCTGCCGGCGTGGACACCAATGTCAGGATCTGGAAGGTAGA
AAAGGGACCAGATGGAAAAGCCATCGTGGAATTTTTGTCCAATCTTGCTCGTCATACCAAAGCCGTCAAT
GTTGTGCGTTTTTCTCCAACTGGGGAAATTTTAGCATCGGGAGGAGATGATGCTGTCATCCTATTGTGGA
AGGTGAATGATAACAAGGAGCCGGAGCAGATCGCTTTTCAGGATGAGGACGAGGCCCAGCTGAACAAGGA
GAACTGGACGGTTGTGAAGACTCTGCGGGGCCACTTAGAAGATGTGTATGATATTTGCTGGGCAACTGAT
GGGAATTTAATGGCTTCTGCCTCTGTGGATAACACAGCCATCATATGGGATGTCAGCAAAGGACAAAAGA
TATCAATTTTTAATGAACATAAAAGTTATGTCCAAGGAGTAACCTGGGACCCTTTGGGTCAATATGTTGC
TACTCTGAGCTGTGACAGGGTGCTGCGAGTATACAGTATACAGAAGAAGCGTGTGGCTTTCAATGTTTCG
AAGATGCTGTCTGGAATAGGGGCTGAAGGAGAGGCAAGAAGCTACCGGATGTTTCACGACGACAGCATGA
AGTCTTTCTTCCGTAGACTGAGTTTCACTCCCGACGGATCTTTGCTTCTCACGCCAGCTGGATGTGTGGA
ATCTGGTGAAAATGTAATGAATACCACTTATGTTTTCTCCAGGAAGAATCTTAAAAGGCCCATCGCTCAT
CTTCCATGTCCTGGAAAAGCCACTCTTGCTGTTCGCTGCTGTCCGGTCTACTTTGAACTGAGGCCAGTGG
TGGAAACAGGTGTGGAGCTGATGAGTCTGCCCTACCGCCTGGTGTTTGCTGTGGCCTCGGAGGATTCCGT
GCTTCTGTATGACACCCAGCAGTCCTTCCCTTTTGGTTACGTGTCTAATATACATTACCACACCCTCAGT
GACATTTCATGGTCCAGCGATGGTGCCTTCCTGGCCATTTCTTCCACGGACGGTTACTGCTCATTTGTGA
CATTTGAGAAAGATGAACTTGGAATTCCTTTGAAAGAGAAGCCAGTTTTGAACATGAGAACTCCTGATAC
AGCAAAGAAAACCAAGAGTCAGACACATCGAGGGTCTTCGCCAGGACCCAGACCGGTAGAGGGAACCCCT
GCCAGCAGAACCCAAGACCCCAGCAGCCCCGGCACGACTCCCCCTCAGGCCAGACAGGCCCCAGCCCCAA
CAGTCATCAGGGACCCTCCCTCCATCACTCCTGCTGTCAAAAGCCCCTTGCCGGGGCCTTCGGAGGAGAA
GACCCTGCAGCCCAGTAGTCAAAACACAAAAGCCCACCCATCCCGGAGGGTCACTCTGAACACACTGCAA
GCCTGGAGCAAGACAACACCCCGGAGAATAAACTTAACACCCTTAAAGACGGACACTCCACCAAGTTCTG
TACCAACCAGTGTGATTTCCACCCCTTCTACAGAAGAAATTCAGTCAGAGACGCCTGGAGACGCTCAGGG
CAGTCCCCCAGAGCTAAAGCGGCCCAGACTCGATGAAAACAAAGGAGGCACGGAAAGTCTGGACCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202858 protein sequence
Red=Cloning site Green=Tags(s)

MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPDGKAIVEFLSNLARHTKAVN
VVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATD
GNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVS
KMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAH
LPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLS
DISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTP
ASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQ
AWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005441
ORF Size 1677 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005441.3
RefSeq Size 2297 bp
RefSeq ORF 1680 bp
Locus ID 8208
UniProt ID Q13112
Cytogenetics 21q22.12-q22.13
Domains WD40
Protein Families Druggable Genome, Transcription Factors
MW 61.5 kDa
Gene Summary Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "CHAF1B"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


CHAF1B mouse monoclonal antibody, clone OTI4F7 (formerly 4F7)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.