p60 CAF1(CHAF1B) (NM_005441) Human Tagged ORF Clone

CAT#: RC202858

CHAF1B (Myc-DDK-tagged)-Human chromatin assembly factor 1, subunit B (p60) (CHAF1B)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name p60 CAF1(CHAF1B) (NM_005441) Human Tagged ORF Clone
Symbol CHAF1B
Synonyms CAF-1; CAF-IP60; CAF1; CAF1A; CAF1P60; MPHOSPH7; MPP7
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC202858 representing NM_005441
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGTCATCACTTGTGAAATAGCCTGGCACAACAAGGAGCCCGTGTACAGCCTGGACTTCCAGCATG
GGACGGCTGGGAGGATCCACAGACTGGCGTCTGCCGGCGTGGACACCAATGTCAGGATCTGGAAGGTAGA
AAAGGGACCAGATGGAAAAGCCATCGTGGAATTTTTGTCCAATCTTGCTCGTCATACCAAAGCCGTCAAT
GTTGTGCGTTTTTCTCCAACTGGGGAAATTTTAGCATCGGGAGGAGATGATGCTGTCATCCTATTGTGGA
AGGTGAATGATAACAAGGAGCCGGAGCAGATCGCTTTTCAGGATGAGGACGAGGCCCAGCTGAACAAGGA
GAACTGGACGGTTGTGAAGACTCTGCGGGGCCACTTAGAAGATGTGTATGATATTTGCTGGGCAACTGAT
GGGAATTTAATGGCTTCTGCCTCTGTGGATAACACAGCCATCATATGGGATGTCAGCAAAGGACAAAAGA
TATCAATTTTTAATGAACATAAAAGTTATGTCCAAGGAGTAACCTGGGACCCTTTGGGTCAATATGTTGC
TACTCTGAGCTGTGACAGGGTGCTGCGAGTATACAGTATACAGAAGAAGCGTGTGGCTTTCAATGTTTCG
AAGATGCTGTCTGGAATAGGGGCTGAAGGAGAGGCAAGAAGCTACCGGATGTTTCACGACGACAGCATGA
AGTCTTTCTTCCGTAGACTGAGTTTCACTCCCGACGGATCTTTGCTTCTCACGCCAGCTGGATGTGTGGA
ATCTGGTGAAAATGTAATGAATACCACTTATGTTTTCTCCAGGAAGAATCTTAAAAGGCCCATCGCTCAT
CTTCCATGTCCTGGAAAAGCCACTCTTGCTGTTCGCTGCTGTCCGGTCTACTTTGAACTGAGGCCAGTGG
TGGAAACAGGTGTGGAGCTGATGAGTCTGCCCTACCGCCTGGTGTTTGCTGTGGCCTCGGAGGATTCCGT
GCTTCTGTATGACACCCAGCAGTCCTTCCCTTTTGGTTACGTGTCTAATATACATTACCACACCCTCAGT
GACATTTCATGGTCCAGCGATGGTGCCTTCCTGGCCATTTCTTCCACGGACGGTTACTGCTCATTTGTGA
CATTTGAGAAAGATGAACTTGGAATTCCTTTGAAAGAGAAGCCAGTTTTGAACATGAGAACTCCTGATAC
AGCAAAGAAAACCAAGAGTCAGACACATCGAGGGTCTTCGCCAGGACCCAGACCGGTAGAGGGAACCCCT
GCCAGCAGAACCCAAGACCCCAGCAGCCCCGGCACGACTCCCCCTCAGGCCAGACAGGCCCCAGCCCCAA
CAGTCATCAGGGACCCTCCCTCCATCACTCCTGCTGTCAAAAGCCCCTTGCCGGGGCCTTCGGAGGAGAA
GACCCTGCAGCCCAGTAGTCAAAACACAAAAGCCCACCCATCCCGGAGGGTCACTCTGAACACACTGCAA
GCCTGGAGCAAGACAACACCCCGGAGAATAAACTTAACACCCTTAAAGACGGACACTCCACCAAGTTCTG
TACCAACCAGTGTGATTTCCACCCCTTCTACAGAAGAAATTCAGTCAGAGACGCCTGGAGACGCTCAGGG
CAGTCCCCCAGAGCTAAAGCGGCCCAGACTCGATGAAAACAAAGGAGGCACGGAAAGTCTGGACCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202858 representing NM_005441
Red=Cloning site Green=Tags(s)

MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPDGKAIVEFLSNLARHTKAVN
VVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATD
GNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVS
KMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAH
LPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLS
DISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTP
ASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQ
AWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005441
ORF Size 1677 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005441.1, NM_005441.2, NP_005432
RefSeq Size 2297
RefSeq ORF 1680
Locus ID 8208
Cytogenetics 21q22.12-q22.13
Domains WD40
Protein Families Transcription Factors, Druggable Genome
MW 61.3 kDa
Gene Summary Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)