VRL1 (TRPV2) (NM_016113) Human Tagged ORF Clone

CAT#: RC202821

Reviews ()
Write a review

TRPV2 (Myc-DDK-tagged)-Human transient receptor potential cation channel, subfamily V, member 2 (TRPV2)



Reconstitution Protocol

USD 700.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TRPV2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRPV2
Synonyms VRL; VRL-1; VRL1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202821 representing NM_016113
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCTCACCCTCCAGCTCTCCAGTTTTCAGGTTGGAGACATTAGATGGAGGCCAAGAAGATGGCTCTG
AGGCGGACAGAGGAAAGCTGGATTTTGGGAGCGGGCTGCCTCCCATGGAGTCACAGTTCCAGGGCGAGGA
CCGGAAATTCGCCCCTCAGATAAGAGTCAACCTCAACTACCGAAAGGGAACAGGTGCCAGTCAGCCGGAT
CCAAACCGATTTGACCGAGATCGGCTCTTCAATGCGGTCTCCCGGGGTGTCCCCGAGGATCTGGCTGGAC
TTCCAGAGTACCTGAGCAAGACCAGCAAGTACCTCACCGACTCGGAATACACAGAGGGCTCCACAGGTAA
GACGTGCCTGATGAAGGCTGTGCTGAACCTTAAGGACGGAGTCAATGCCTGCATTCTGCCACTGCTGCAG
ATCGACAGGGACTCTGGCAATCCTCAGCCCCTGGTAAATGCCCAGTGCACAGATGACTATTACCGAGGCC
ACAGCGCTCTGCACATCGCCATTGAGAAGAGGAGTCTGCAGTGTGTGAAGCTCCTGGTGGAGAATGGGGC
CAATGTGCATGCCCGGGCCTGCGGCCGCTTCTTCCAGAAGGGCCAAGGGACTTGCTTTTATTTCGGTGAG
CTACCCCTCTCTTTGGCCGCTTGCACCAAGCAGTGGGATGTGGTAAGCTACCTCCTGGAGAACCCACACC
AGCCCGCCAGCCTGCAGGCCACTGACTCCCAGGGCAACACAGTCCTGCATGCCCTAGTGATGATCTCGGA
CAACTCAGCTGAGAACATTGCACTGGTGACCAGCATGTATGATGGGCTCCTCCAAGCTGGGGCCCGCCTC
TGCCCTACCGTGCAGCTTGAGGACATCCGCAACCTGCAGGATCTCACGCCTCTGAAGCTGGCCGCCAAGG
AGGGCAAGATCGAGATTTTCAGGCACATCCTGCAGCGGGAGTTTTCAGGACTGAGCCACCTTTCCCGAAA
GTTCACCGAGTGGTGCTATGGGCCTGTCCGGGTGTCGCTGTATGACCTGGCTTCTGTGGACAGCTGTGAG
GAGAACTCAGTGCTGGAGATCATTGCCTTTCATTGCAAGAGCCCGCACCGACACCGAATGGTCGTTTTGG
AGCCCCTGAACAAACTGCTGCAGGCGAAATGGGATCTGCTCATCCCCAAGTTCTTCTTAAACTTCCTGTG
TAATCTGATCTACATGTTCATCTTCACCGCTGTTGCCTACCATCAGCCTACCCTGAAGAAGCAGGCCGCC
CCTCACCTGAAAGCGGAGGTTGGAAACTCCATGCTGCTGACGGGCCACATCCTTATCCTGCTAGGGGGGA
TCTACCTCCTCGTGGGCCAGCTGTGGTACTTCTGGCGGCGCCACGTGTTCATCTGGATCTCGTTCATAGA
CAGCTACTTTGAAATCCTCTTCCTGTTCCAGGCCCTGCTCACAGTGGTGTCCCAGGTGCTGTGTTTCCTG
GCCATCGAGTGGTACCTGCCCCTGCTTGTGTCTGCGCTGGTGCTGGGCTGGCTGAACCTGCTTTACTATA
CACGTGGCTTCCAGCACACAGGCATCTACAGTGTCATGATCCAGAAGGTCATCCTGCGGGACCTGCTGCG
CTTCCTTCTGATCTACTTAGTCTTCCTTTTCGGCTTCGCTGTAGCCCTGGTGAGCCTGAGCCAGGAGGCT
TGGCGCCCCGAAGCTCCTACAGGCCCCAATGCCACAGAGTCAGTGCAGCCCATGGAGGGACAGGAGGACG
AGGGCAACGGGGCCCAGTACAGGGGTATCCTGGAAGCCTCCTTGGAGCTCTTCAAATTCACCATCGGCAT
GGGCGAGCTGGCCTTCCAGGAGCAGCTGCACTTCCGCGGCATGGTGCTGCTGCTGCTGCTGGCCTACGTG
CTGCTCACCTACATCCTGCTGCTCAACATGCTCATCGCCCTCATGAGCGAGACCGTCAACAGTGTCGCCA
CTGACAGCTGGAGCATCTGGAAGCTGCAGAAAGCCATCTCTGTCCTGGAGATGGAGAATGGCTATTGGTG
GTGCAGGAAGAAGCAGCGGGCAGGTGTGATGCTGACCGTTGGCACTAAGCCAGATGGCAGCCCCGATGAG
CGCTGGTGCTTCAGGGTGGAGGAGGTGAACTGGGCTTCATGGGAGCAGACGCTGCCTACGCTGTGTGAGG
ACCCGTCAGGGGCAGGTGTCCCTCGAACTCTCGAGAACCCTGTCCTGGCTTCCCCTCCCAAGGAGGATGA
GGATGGTGCCTCTGAGGAAAACTATGTGCCCGTCCAGCTCCTCCAGTCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202821 representing NM_016113
Red=Cloning site Green=Tags(s)

MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPD
PNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQ
IDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGE
LPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARL
CPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCE
ENSVLEIIAFHCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALLTVVSQVLCFL
AIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLLIYLVFLFGFAVALVSLSQEA
WRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLELFKFTIGMGELAFQEQLHFRGMVLLLLLAYV
LLTYILLLNMLIALMSETVNSVATDSWSIWKLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDE
RWCFRVEEVNWASWEQTLPTLCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016113
ORF Size 2292 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016113.5
RefSeq Size 2797 bp
RefSeq ORF 2295 bp
Locus ID 51393
UniProt ID Q9Y5S1
Cytogenetics 17p11.2
Domains ANK, ion_trans
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane
MW 85.8 kDa
Gene Summary This gene encodes an ion channel that is activated by high temperatures above 52 degrees Celsius. The protein may be involved in transduction of high-temperature heat responses in sensory ganglia. It is thought that in other tissues the channel may be activated by stimuli other than heat. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.