IMPA1 (NM_005536) Human Tagged ORF Clone

CAT#: RC202784

IMPA1 (Myc-DDK-tagged)-Human inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1), transcript variant 1

Product Images

Circular map for RC202784

• 

  Western blot validation of overexpression lysate (Cat# LY417241) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC202784 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified IMPA1 protein (Cat# TP302784). The protein was produced from HEK293T cells transfected with IMPA1 cDNA clone (Cat# RC202784) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: IMPA1
• Synonyms: IMP; IMPA; MRT59
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC202784 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGATCCTTGGCAGGAATGCATGGATTATGCAGTAACTCTAGCAAGACAAGCTGGAGAGGTAGTTT
  GTGAAGCTATAAAAAATGAAATGAATGTTATGCTGAAAAGTTCTCCAGTTGATTTGGTAACTGCTACGGA
  CCAAAAAGTTGAAAAAATGCTTATCTCTTCCATAAAGGAAAAGTATCCATCTCACAGTTTCATTGGTGAA
  GAATCTGTGGCAGCTGGGGAAAAAAGTATCTTAACCGACAACCCCACATGGATCATTGACCCTATTGATG
  GAACAACTAACTTTGTACATAGATTTCCTTTTGTAGCTGTTTCAATTGGCTTTGCTGTAAATAAAAAGAT
  AGAATTTGGAGTTGTGTACAGTTGTGTGGAAGGCAAGATGTACACTGCCAGAAAAGGAAAAGGTGCCTTT
  TGTAATGGTCAAAAACTACAAGTCTCACAACAAGAAGATATTACCAAATCTCTCTTGGTGACTGAGTTGG
  GCTCTTCCAGAACACCAGAGACTGTGAGAATGGTTCTTTCTAATATGGAAAAGCTTTTTTGCATTCCTGT
  TCATGGGATCCGGAGTGTTGGAACAGCAGCTGTTAATATGTGCCTTGTGGCAACTGGCGGAGCAGATGCA
  TATTATGAAATGGGAATTCACTGCTGGGATGTTGCAGGAGCTGGCATTATTGTTACTGAAGCTGGTGGCG
  TGCTAATGGATGTTACAGGTGGACCATTTGATTTGATGTCACGAAGAGTAATTGCTGCAAATAATAGAAT
  ATTAGCAGAAAGGATAGCTAAAGAAATTCAGGTTATACCTTTGCAACGAGACGACGAAGAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC202784 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGE
  ESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAF
  CNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADA
  YYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005536
• ORF Size: 831 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005536.4
• RefSeq Size: 3396 bp
• RefSeq ORF: 834 bp
• Locus ID: 3612
• UniProt ID: P29218
• Cytogenetics: 8q21.13
• Domains: inositol_P
• Protein Families: Druggable Genome
• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
• MW: 30.2 kDa
• Gene Summary: This gene encodes an enzyme that dephosphorylates myo-inositol monophosphate to generate free myo-inositol, a precursor of phosphatidylinositol, and is therefore an important modulator of intracellular signal transduction via the production of the second messengers myoinositol 1,4,5-trisphosphate and diacylglycerol. This enzyme can also use myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate, scyllo-inositol-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. This enzyme shows magnesium-dependent phosphatase activity and is inhibited by therapeutic concentrations of lithium. Inhibition of inositol monophosphate hydroylosis and subsequent depletion of inositol for phosphatidylinositol synthesis may explain the anti-manic and anti-depressive effects of lithium administered to treat bipolar disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. A pseudogene of this gene is also present on chromosome 8q21.13. [provided by RefSeq, Dec 2014]