PSMD6 (NM_014814) Human Tagged ORF Clone

CAT#: RC202292

Reviews ()
Write a review

PSMD6 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 (PSMD6)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PSMD6
Synonyms p42A; p44S10; Rpn7; S10; SGA-113M
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC202292 representing NM_014814
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCTGGAGAACCTGGAGGAGGAGGGTCTGCCCAAGAACCCCGACTTGCGTATCGCGCAGCTGCGCT
TCCTGCTCAGCCTGCCCGAGCACCGCGGAGACGCTGCCGTGCGCGACGAGCTGATGGCGGCCGTCCGCGA
TAACAACATGGCTCCTTACTATGAAGCCTTGTGCAAATCCCTCGACTGGCAGATAGACGTGGACCTACTC
AATAAAATGAAGAAGGCAAATGAAGATGAGTTGAAGCGTTTGGATGAGGAGCTGGAAGATGCAGAGAAGA
ATCTAGGAGAGAGCGAAATTCGCGATGCAATGATGGCAAAGGCCGAGTACCTCTGCCGGATAGGTGACAA
AGAGGGAGCTCTGACAGCCTTTCGCAAGACATATGACAAAACTGTGGCCCTGGGTCACCGATTGGATATT
GTATTCTATCTCCTTAGGATTGGCTTATTTTATATGGATAATGATCTCATCACACGAAACACAGAAAAGG
CCAAAAGCTTAATAGAAGAAGGAGGAGACTGGGACAGGAGAAACCGCCTAAAAGTGTATCAGGGTCTTTA
TTGTGTGGCTATTCGTGATTTCAAACAGGCAGCTGAACTCTTCCTTGACACTGTTTCAACATTTACATCC
TATGAACTCATGGATTATAAAACATTTGTGACTTATACTGTCTATGTCAGTATGATTGCCTTAGAAAGAC
CAGATCTCAGGGAAAAGGTCATTAAAGGAGCAGAGATTCTTGAAGTGTTGCACAGTCTTCCAGCAGTTCG
GCAGTATCTGTTTTCACTCTATGAATGCCGTTACTCTGTTTTCTTCCAATCATTAGCGGTTGTGGAACAG
GAAATGAAAAAGGACTGGCTTTTTGCCCCTCATTATCGATACTATGTAAGAGAAATGAGAATTCATGCAT
ACAGTCAGCTGCTGGAATCATATAGGTCATTAACCCTTGGCTATATGGCAGAAGCGTTTGGTGTTGGTGT
GGAATTCATTGATCAGGAACTGTCCAGGTTTATTGCTGCCGGGAGACTACACTGCAAAATAGATAAAGTG
AATGAAATAGTAGAAACCAACAGACCTGATAGCAAGAACTGGCAGTACCAAGAAACTATCAAGAAAGGAG
ATCTGCTACTAAACAGAGTTCAAAAACTTTCCAGAGTAATTAATATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202292 representing NM_014814
Red=Cloning site Green=Tags(s)

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLL
NKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDI
VFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTS
YELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQ
EMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKV
NEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014814
ORF Size 1167 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014814.3
RefSeq Size 1308 bp
RefSeq ORF 1170 bp
Locus ID 9861
UniProt ID Q15008
Cytogenetics 3p14.1
Domains PCI
Protein Pathways Proteasome
MW 45.4 kDa
Gene Summary This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]
Other products for "PSMD6"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.