Cystathionase(CTH) (NM_001902) Human Tagged ORF Clone

CAT#: RC202195

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cystathionase(CTH) (NM_001902) Human Tagged ORF Clone
Symbol CTH
Synonyms MGC9471
Vector pCMV6-Entry
Sequence Data
>RC202195 representing NM_001902
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGAAAAAGACGCCTCCTCACAAGGTTTCCTGCCACACTTCCAACATTTCGCCACGCAGGCGATCC
ATGTGGGCCAGGATCCAGAGCAATGGACCTCCAGGGCTGTAGTGCCCCCCATCTCACTGTCCACCACGTT
CAAGCAAGGGGCGCCTGGCCAGCACTCGGGTTTTGAATATAGCCGTTCTGGAAATCCCACTAGGAATTGC
CTTGAAAAAGCAGTGGCAGCACTGGATGGGGCTAAGTACTGTTTGGCCTTTGCTTCAGGTTTAGCAGCCA
CTGTAACTATTACCCATCTTTTAAAAGCAGGAGACCAAATTATTTGTATGGATGATGTGTATGGAGGTAC
AAACAGGTACTTCAGGCAAGTGGCATCTGAATTTGGATTAAAGATTTCTTTTGTTGATTGTTCCAAAATC
AAATTACTAGAGGCAGCAATTACACCAGAAACCAAGCTTGTTTGGATCGAAACCCCCACAAACCCCACCC
AGAAGGTGATTGACATTGAAGGCTGTGCACATATTGTCCATAAGCATGGAGACATTATTTTGGTCGTGGA
TAACACTTTTATGTCACCATATTTCCAGCGCCCTTTGGCTCTGGGAGCTGATATTTCTATGTATTCTGCA
ACAAAATACATGAATGGCCACAGTGATGTTGTAATGGGCCTGGTGTCTGTTAATTGTGAAAGCCTTCATA
ATAGACTTCGTTTCTTGCAAAACTCTCTTGGAGCAGTTCCATCTCCTATTGATTGTTACCTCTGCAATCG
AGGTCTGAAGACTCTACATGTCCGAATGGAAAAGCATTTCAAAAACGGAATGGCAGTTGCCCAGTTCCTG
GAATCTAATCCTTGGGTAGAAAAGGTTATTTATCCTGGGCTGCCCTCTCATCCACAGCATGAGTTGGTGA
AGCGTCAGTGTACAGGTTGTACAGGGATGGTCACCTTTTATATTAAGGGCACTCTTCAGCATGCTGAGAT
TTTCCTCAAGAACCTAAAGCTATTTACTCTGGCCGAGAGCTTGGGAGGATTCGAAAGCCTTGCTGAGCTT
CCGGCAATCATGACTCATGCATCAGTTCTTAAGAATGACAGAGATGTCCTTGGAATTAGTGACACACTGA
TTCGACTTTCTGTGGGCTTAGAGGATGAGGAAGACCTACTGGAAGATCTAGATCAAGCTTTGAAGGCAGC
ACACCCTCCAAGTGGAAGTCACAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC202195 representing NM_001902
Red=Cloning site Green=Tags(s)

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA
TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001902
ORF Size 1215 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001902.1, NM_001902.2, NM_001902.3, NM_001902.4, NM_001902.5, NP_001893
RefSeq Size 1819
RefSeq ORF 1218
Locus ID 1491
Cytogenetics 1p31.1
Protein Pathways Glycine, serine and threonine metabolism, Cysteine and methionine metabolism, Selenoamino acid metabolism, Nitrogen metabolism, Metabolic pathways
MW 44.3 kDa
Gene Summary This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)