Grp75 (HSPA9) (NM_004134) Human Tagged ORF Clone

CAT#: RC201397

Reviews ()
Write a review

HSPA9 (Myc-DDK-tagged)-Human heat shock 70kDa protein 9 (mortalin) (HSPA9), nuclear gene encoding mitochondrial protein



  "NM_004134" in other vectors (6)

USD 628.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Grp75 (HSPA9) (NM_004134) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HSPA9
Synonyms CRP40; CSA; EVPLS; GRP-75; GRP75; HEL-S-124m; HSPA9B; MOT; MOT2; MTHSP75; PBP74; SAAN; SIDBA4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201397 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATAAGTGCCAGCCGAGCTGCAGCAGCCCGTCTCGTGGGCGCCGCAGCCTCCCGGGGCCCTACGGCCG
CCCGCCACCAGGATAGCTGGAATGGCCTTAGTCATGAGGCTTTTAGACTTGTTTCAAGGCGGGATTATGC
ATCAGAAGCAATCAAGGGAGCAGTTGTTGGTATTGATTTGGGTACTACCAACTCCTGCGTGGCAGTTATG
GAAGGTAAACGAGCAAAGGTGCTGGAGAATGCCGAAGGTGCCAGAACCACCCCTTCAGTTGTGGCCTTTA
CAGCAGATGGTGAGCGACTTGTTGGAATGCCGGCCAAGCGACAGGCTGTCACCAACCCAAACAATACATT
TTATGCTACCAAGCGTCTCATTGGCCGGCGATATGATGATCCTGAAGTACAGAAAGACATTAAAAATGTT
CCCTTTAAAATTGTCCGTGCCTCCAATGGTGATGCCTGGGTTGAGGCTCATGGGAAATTGTATTCTCCGA
GTCAGATTGGAGCATTTGTGTTGATGAAGATGAAAGAGACTGCAGAAAATTACTTGGGGCGCACAGCAAA
AAATGCTGTGATCACAGTCCCAGCTTATTTCAATGACTCGCAGAGACAGGCCACTAAAGATGCTGGCCAG
ATATCTGGACTGAATGTGCTTCGGGTGATTAATGAGCCCACAGCTGCTGCTCTTGCCTATGGTCTAGACA
AATCAGAAGACAAAGTCATTGCTGTATATGATTTAGGTGGTGGAACTTTTGATATTTCTATCCTGGAAAT
TCAGAAAGGAGTATTTGAGGTGAAATCCACAAATGGGGATACCTTCTTAGGTGGGGAAGACTTTGACCAG
GCCTTGCTACGGCACATTGTGAAGGAGTTCAAGAGAGAGACAGGGGTTGATTTGACTAAAGACAACATGG
CACTTCAGAGGGTACGGGAAGCTGCTGAAAAGGCTAAGTGTGAACTCTCCTCATCTGTGCAGACTGACAT
CAATTTGCCCTATCTTACAATGGATTCTTCTGGACCCAAGCATTTGAATATGAAGTTGACCCGTGCTCAA
TTTGAAGGGATTGTCACTGATCTAATCAGAAGGACTATCGCTCCATGCCAAAAAGCTATGCAAGATGCAG
AAGTCAGCAAGAGTGACATAGGAGAAGTGATTCTTGTGGGTGGCATGACTAGGATGCCCAAGGTTCAGCA
GACTGTACAGGATCTTTTTGGCAGAGCCCCAAGTAAAGCTGTCAATCCTGATGAGGCTGTGGCCATTGGA
GCTGCCATTCAGGGAGGTGTGTTGGCCGGCGATGTCACGGATGTGCTGCTCCTTGATGTCACTCCCCTGT
CTCTGGGTATTGAAACTCTAGGAGGTGTCTTTACCAAACTTATTAATAGGAATACCACTATTCCAACCAA
GAAGAGCCAGGTATTCTCTACTGCCGCTGATGGTCAAACGCAAGTGGAAATTAAAGTGTGTCAGGGTGAA
AGAGAGATGGCTGGAGACAACAAACTCCTTGGACAGTTTACTTTGATTGGAATTCCACCAGCCCCTCGTG
GAGTTCCTCAGATTGAAGTTACATTTGACATTGATGCCAATGGGATAGTACATGTTTCTGCTAAAGATAA
AGGCACAGGACGTGAGCAGCAGATTGTAATCCAGTCTTCTGGTGGATTAAGCAAAGATGATATTGAAAAT
ATGGTTAAAAATGCAGAGAAATATGCTGAAGAAGACCGGCGAAAGAAGGAACGAGTTGAAGCAGTTAATA
TGGCTGAAGGAATCATTCACGACACAGAAACCAAGATGGAAGAATTCAAGGACCAATTACCTGCTGATGA
GTGCAACAAGCTGAAAGAAGAGATTTCCAAAATGAGGGAGCTCCTGGCTAGAAAAGACAGCGAAACAGGA
GAAAATATTAGACAGGCAGCATCCTCTCTTCAGCAGGCATCATTGAAGCTGTTCGAAATGGCATACAAAA
AGATGGCATCTGAGCGAGAAGGCTCTGGAAGTTCTGGCACTGGGGAACAAAAGGAAGATCAAAAGGAGGA
AAAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201397 protein sequence
Red=Cloning site Green=Tags(s)

MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVM
EGKRAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNV
PFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGRTAKNAVITVPAYFNDSQRQATKDAGQ
ISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQ
ALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQ
FEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIG
AAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGE
REMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIEN
MVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETG
ENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004134
ORF Size 2037 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004134.2
RefSeq Size 3506 bp
RefSeq ORF 2040 bp
Locus ID 3313
Cytogenetics 5q31.2
Domains HSP70
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
MW 73.7 kDa
Gene Summary This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.[provided by RefSeq, May 2010]

Citations (2)

Other Versions

Other products for "HSPA9"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


HSPA9 mouse monoclonal antibody, clone OTI9F8 (formerly 9F8)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools