CBR3 (NM_001236) Human Tagged ORF Clone

CAT#: RC201073

Reviews ()
Write a review

CBR3 (Myc-DDK-tagged)-Human carbonyl reductase 3 (CBR3)



  "NM_001236" in other vectors (4)

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CBR3 (NM_001236) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CBR3
Synonyms hCBR3; HEL-S-25; SDR21C2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC201073 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCCTGCAGCCGCGTGGCGCTGGTGACCGGGGCCAACAGGGGCATCGGCTTGGCCATCGCGCGCG
AACTGTGCCGACAGTTCTCTGGGGATGTGGTGCTCACCGCGCGGGACGTGGCGCGGGGCCAGGCGGCCGT
GCAGCAGCTGCAGGCGGAGGGCCTGAGCCCGCGCTTCCACCAACTGGACATCGACGACTTGCAGAGCATC
CGCGCCCTGCGCGACTTCCTGCGCAAGGAGTACGGGGGGCTCAATGTACTGGTCAACAACGCGGCCGTCG
CCTTCAAGAGTGATGATCCAATGCCCTTTGACATTAAAGCTGAGATGACACTGAAGACAAATTTTTTTGC
CACTAGAAACATGTGCAACGAGTTACTGCCGATAATGAAACCTCATGGGAGAGTGGTGAATATCAGTAGT
TTGCAGTGTTTAAGGGCTTTTGAAAACTGCAGTGAAGATCTGCAGGAAAGGTTCCACAGTGAGACACTCA
CAGAAGGAGACCTGGTGGATCTCATGAAAAAGTTTGTGGAGGACACAAAAAATGAGGTGCATGAGAGGGA
AGGCTGGCCCAACTCACCTTATGGGGTGTCCAAGTTGGGGGTCACAGTCTTATCGAGGATCCTGGCCAGG
CGTCTGGATGAGAAGAGGAAAGCTGACAGGATTCTGGTGAATGCGTGCTGCCCAGGACCAGTGAAGACAG
ACATGGATGGGAAAGACAGCATCAGGACTGTGGAGGAGGGGGCTGAGACCCCTGTCTACTTGGCCCTCTT
GCCTCCAGATGCCACTGAGCCACAAGGCCAGTTGGTCCATGACAAAGTTGTGCAAAACTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC201073 protein sequence
Red=Cloning site Green=Tags(s)

MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI
RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS
LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR
RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001236
ORF Size 831 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001236.4
RefSeq Size 1128 bp
RefSeq ORF 834 bp
Locus ID 874
Cytogenetics 21q22.12
Protein Families Druggable Genome
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
MW 30.9 kDa
Gene Summary Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "CBR3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


CBR3 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools