CBR3 (NM_001236) Human Tagged ORF Clone

CAT#: RC201073

CBR3 (Myc-DDK-tagged)-Human carbonyl reductase 3 (CBR3)

Product Images

Circular map for RC201073

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY CBR3 (Cat# RC201073, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-CBR3(Cat# TA503225). Positive lysates LY420049 (100ug) and LC420049 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY420049) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC201073 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified CBR3 protein (Cat# TP301073). The protein was produced from HEK293T cells transfected with CBR3 cDNA clone (Cat# RC201073) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CBR3
• Synonyms: hCBR3; HEL-S-25; SDR21C2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC201073 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGTCCTGCAGCCGCGTGGCGCTGGTGACCGGGGCCAACAGGGGCATCGGCTTGGCCATCGCGCGCG
  AACTGTGCCGACAGTTCTCTGGGGATGTGGTGCTCACCGCGCGGGACGTGGCGCGGGGCCAGGCGGCCGT
  GCAGCAGCTGCAGGCGGAGGGCCTGAGCCCGCGCTTCCACCAACTGGACATCGACGACTTGCAGAGCATC
  CGCGCCCTGCGCGACTTCCTGCGCAAGGAGTACGGGGGGCTCAATGTACTGGTCAACAACGCGGCCGTCG
  CCTTCAAGAGTGATGATCCAATGCCCTTTGACATTAAAGCTGAGATGACACTGAAGACAAATTTTTTTGC
  CACTAGAAACATGTGCAACGAGTTACTGCCGATAATGAAACCTCATGGGAGAGTGGTGAATATCAGTAGT
  TTGCAGTGTTTAAGGGCTTTTGAAAACTGCAGTGAAGATCTGCAGGAAAGGTTCCACAGTGAGACACTCA
  CAGAAGGAGACCTGGTGGATCTCATGAAAAAGTTTGTGGAGGACACAAAAAATGAGGTGCATGAGAGGGA
  AGGCTGGCCCAACTCACCTTATGGGGTGTCCAAGTTGGGGGTCACAGTCTTATCGAGGATCCTGGCCAGG
  CGTCTGGATGAGAAGAGGAAAGCTGACAGGATTCTGGTGAATGCGTGCTGCCCAGGACCAGTGAAGACAG
  ACATGGATGGGAAAGACAGCATCAGGACTGTGGAGGAGGGGGCTGAGACCCCTGTCTACTTGGCCCTCTT
  GCCTCCAGATGCCACTGAGCCACAAGGCCAGTTGGTCCATGACAAAGTTGTGCAAAACTGG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC201073 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSCSRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQAAVQQLQAEGLSPRFHQLDIDDLQSI
  RALRDFLRKEYGGLNVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISS
  LQCLRAFENCSEDLQERFHSETLTEGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVLSRILAR
  RLDEKRKADRILVNACCPGPVKTDMDGKDSIRTVEEGAETPVYLALLPPDATEPQGQLVHDKVVQNW
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001236
• ORF Size: 831 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001236.4
• RefSeq Size: 1128 bp
• RefSeq ORF: 834 bp
• Locus ID: 874
• UniProt ID: O75828
• Cytogenetics: 21q22.12
• Protein Families: Druggable Genome
• Protein Pathways: Arachidonic acid metabolism, Metabolic pathways
• MW: 30.9 kDa
• Gene Summary: Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1. [provided by RefSeq, Jul 2008]