PPP2R5D (NM_180976) Human Tagged ORF Clone

CAT#: RC200647

Reviews ()
Write a review

PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2


Product Datasheet for 'RC200647'


  "NM_180976" in other vectors (4)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PPP2R5D (NM_180976) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PPP2R5D
Synonyms B56D; B56delta; MRD35
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200647 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTATAAACTGAAAAAGGAGAAGGAGCCCCCCAAGGTTGCCAAATGCACAGCCAAGCCTAGCAGCT
CGGGCAAGGATGGTGGAGGCGAGAACACTGAGGAGGCCCAGCCGCAGCCCCAGCCCCAGCCCCAGCCCCA
AGCCCAGTCTCAGCCACCGTCATCCAACAAGCGTCCCAGCAATAGCACGCCGCCCCCCACGCAGCTCAGC
AAAATCAAGTACTCAGGGGGGCCCCAGATTGTCAAGAAGGAGCTGTTTATCCAGAAGCTACGCCAGTGCT
GTGTCCTCTTTGACTTCGTGTCAGACCCACTCAGTGACCTCAAATTCAAGGAGGTGAAGCGGGCAGGACT
CAACGAGATGGTGGAGTACATCACCCATAGCCGTGATGTTGTCACTGAGGCCATTTACCCTGAGGCTGTC
ACCATGTTTTCAGTGAACCTCTTCCGGACGCTGCCACCTTCATCGAATCCCACAGGGGCTGAGTTTGACC
CAGAGGAAGATGAGCCCACCCTGGAAGCTGCTTGGCCACATCTCCAGCTCGTGTATGAGTTCTTCTTACG
TTTCCTTGAGTCTCCTGATTTCCAGCCAAACATAGCCAAGAAGTACATCGACCAGAAGTTTGTACTTGCT
CTCCTAGACCTATTTGACAGTGAGGATCCTCGAGAGCGGGACTTCCTCAAGACCATTTTGCATCGCATCT
ATGGCAAGTTTTTGGGGCTCCGGGCTTATATCCGTAGGCAGATCAACCACATCTTCTACAGGTTCATCTA
CGAGACGGAGCATCACAACGGGATTGCTGAGCTCCTGGAGATCCTGGGCAGCATCATCAATGGCTTTGCC
CTGCCCCTTAAAGAAGAGCACAAGATGTTCCTCATCCGTGTCCTACTTCCCCTTCACAAGGTCAAGTCCC
TGAGTGTCTACCACCCTCAGCTGGCATACTGTGTGGTACAATTCCTGGAGAAGGAGAGCAGTCTGACTGA
GCCGGTAATTGTGGGACTTCTCAAGTTTTGGCCCAAGACCCACAGCCCCAAGGAGGTGATGTTCTTGAAT
GAGCTGGAGGAGATTCTGGACGTCATTGAACCTTCTGAGTTCAGCAAAGTGATGGAACCCCTCTTCCGCC
AGCTGGCCAAGTGTGTCTCTAGCCCCCATTTCCAGGTGGCAGAGCGTGCTCTCTATTACTGGAACAATGA
GTACATCATGAGCCTGATAAGTGACAATGCTGCCCGAGTCCTCCCCATCATGTTCCCTGCACTCTACAGG
AACTCCAAGAGCCACTGGAACAAGACAATCCATGGACTGATCTATAATGCCCTGAAGTTGTTTATGGAAA
TGAATCAGAAGCTGTTTGATGACTGCACACAACAATACAAGGCAGAGAAGCAGAAGGGCCGGTTCCGAAT
GAAGGAAAGGGAAGAGATGTGGCAAAAAATCGAGGAGCTGGCCCGGCTTAATCCCCAGTATCCCATGTTC
CGAGCCCCTCCACCACTGCCCCCTGTGTACTCGATGGAGACAGAGACCCCCACAGCTGAGGACATCCAGC
TTCTGAAGAGGACTGTGGAGACTGAGGCTGTTCAGATGCTAAAAGACATCAAGAAGGAGAAAGTGCTGCT
GCGGAGGAAGTCGGAGCTGCCCCAGGACGTGTACACCATCAAGGCACTGGAGGCGCACAAGCGGGCGGAA
GAGTTCCTAACTGCCAGCCAGGAGGCTCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200647 protein sequence
Red=Cloning site Green=Tags(s)

MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPSNSTPPPTQLS
KIKYSGGPQIVKKELFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAV
TMFSVNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLA
LLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAELLEILGSIINGFA
LPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEPVIVGLLKFWPKTHSPKEVMFLN
ELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAARVLPIMFPALYR
NSKSHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMF
RAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAE
EFLTASQEAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_180976
ORF Size 1710 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_180976.1, NM_180976.2, NP_851307.1
RefSeq Size 2969
RefSeq ORF 1713
Locus ID 5528
Cytogenetics 6p21.1
Protein Families Phosphatase
Protein Pathways Oocyte meiosis, Wnt signaling pathway
MW 66.2 kDa
Gene Summary The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PPP2R5D"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


PPP2R5D mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools