Spermine synthase (SMS) (NM_004595) Human Tagged ORF Clone

CAT#: RC200619

Reviews ()
Write a review

SMS (Myc-DDK-tagged)-Human spermine synthase (SMS)



Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SMS
Synonyms MRSR; SPMSY; SpS; SRS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200619 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCAGCACGGCACAGCACGCTCGACTTCATGCTCGGCGCCAAAGCTGATGGTGAGACCATTCTAA
AAGGCCTCCAGTCCATTTTCCAGGAGCAGGGGATGGCGGAGTCGGTGCACACCTGGCAGGACCATGGCTA
TTTAGCAACCTACACAAACAAGAACGGCAGCTTTGCCAATTTGAGAATTTACCCACATGGATTGGTGTTG
CTGGACCTTCAGAGTTATGATGGTGATGCGCAAGGCAAAGAAGAGATCGACAGTATTTTGAACAAAGTAG
AGGAAAGAATGAAAGAATTGAGTCAGGACAGTACTGGGCGGGTGAAACGATTACCACCCATAGTGCGAGG
AGGAGCCATCGACAGATACTGGCCCACCGCCGACGGGCGCCTGGTTGAATATGACATAGATGAAGTGGTA
TATGACGAAGATTCACCTTATCAAAATATAAAAATTCTACACTCGAAGCAGTTTGGAAATATTCTCATCC
TTAGTGGGGATGTTAATTTGGCAGAGAGTGATTTGGCATATACCCGGGCCATCATGGGCAGTGGCAAAGA
AGATTACACTGGCAAAGATGTACTCATTCTGGGAGGTGGAGACGGAGGCATATTGTGTGAAATAGTCAAA
CTAAAACCAAAGATGGTCACTATGGTAGAGATTGACCAAATGGTGATTGATGGGTGTAAGAAATACATGC
GAAAAACGTGTGGCGATGTCTTAGACAATCTTAAAGGAGACTGCTATCAGGTTCTAATAGAAGACTGTAT
CCCGGTACTGAAGAGGTACGCCAAAGAAGGGAGAGAATTTGATTATGTGATTAATGATTTGACAGCTGTT
CCAATCTCCACGTCTCCAGAAGAAGATTCCACATGGGAGTTTCTCAGACTGATTCTTGACCTCTCAATGA
AAGTGTTGAAACAGGATGGGAAATATTTTACACAGGGGAACTGTGTCAATCTGACAGAAGCACTGTCGCT
CTATGAAGAACAGCTGGGGCGCCTGTATTGTCCTGTGGAATTTTCAAAGGAGATCGTCTGTGTCCCTTCA
TACTTGGAATTGTGGGTATTTTACACTGTTTGGAAGAAAGCTAAACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200619 protein sequence
Red=Cloning site Green=Tags(s)

MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVL
LDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVV
YDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVK
LKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAV
PISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPS
YLELWVFYTVWKKAKP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004595
ORF Size 1098 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004595.5
RefSeq Size 1868 bp
RefSeq ORF 1101 bp
Locus ID 6611
UniProt ID P52788
Cytogenetics Xp22.11
Domains Spermine_synth
Protein Pathways Arginine and proline metabolism, beta-Alanine metabolism, Cysteine and methionine metabolism, Glutathione metabolism, Metabolic pathways
MW 41.3 kDa
Gene Summary This gene encodes a protein belonging to the spermidine/spermin synthase family and catalyzes the production of spermine from spermidine. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene cause an X-linked intellectual disability called Snyder-Robinson Syndrome (SRS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.