NMT1 (NM_021079) Human Tagged ORF Clone

CAT#: RC200594

Reviews ()
Write a review

NMT1 (Myc-DDK-tagged)-Human N-myristoyltransferase 1 (NMT1)



Reconstitution Protocol

USD 457.00

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NMT1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NMT1
Synonyms NMT
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200594 representing NM_021079
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGAGAGTGAGACAGCAGTGAAGCCGCCGGCACCTCCGCTGCCGCAGATGATGGAAGGGAACG
GGAACGGCCATGAGCACTGCAGCGATTGCGAGAATGAGGAGGACAACAGCTACAACCGGGGTGGTTTGAG
TCCAGCCAATGACACTGGAGCCAAAAAGAAGAAAAAGAAACAAAAAAAGAAGAAAGAAAAAGGCAGTGAG
ACAGATTCAGCCCAGGATCAGCCTGTGAAGATGAACTCTTTGCCAGCAGAGAGGATCCAGGAAATACAGA
AGGCCATTGAGCTGTTCTCAGTGGGTCAGGGACCTGCCAAAACCATGGAGGAGGCTAGCAAGCGAAGCTA
CCAGTTCTGGGATACGCAGCCCGTCCCCAAGCTGGGCGAAGTGGTGAACACCCATGGCCCCGTGGAGCCT
GACAAGGACAATATCCGCCAGGAGCCCTACACCCTGCCCCAGGGCTTCACCTGGGATGCTTTGGACCTGG
GCGATCGTGGTGTGCTAAAAGAACTGTACACCCTCCTGAATGAGAACTATGTGGAAGATGATGACAACAT
GTTCCGATTTGATTATTCCCCGGAGTTTCTTTTGTGGGCTCTCCGGCCACCCGGCTGGCTCCCCCAGTGG
CACTGTGGGGTTCGAGTGGTCTCAAGTCGGAAATTGGTTGGGTTCATTAGCGCCATCCCAGCAAACATCC
ATATCTATGACACAGAGAAGAAGATGGTAGAGATCAACTTCCTGTGTGTCCACAAGAAGCTGCGTTCCAA
GAGGGTTGCTCCAGTTCTGATCCGAGAGATCACCAGGCGGGTTCACCTGGAGGGCATCTTCCAAGCAGTT
TACACTGCCGGGGTGGTACTACCAAAGCCCGTTGGCACCTGCAGGTATTGGCATCGGTCCCTAAACCCAC
GGAAGCTGATTGAAGTGAAGTTCTCCCACCTGAGCAGAAATATGACCATGCAGCGCACCATGAAGCTCTA
CCGACTGCCAGAGACTCCCAAGACAGCTGGGCTGCGACCAATGGAAACAAAGGACATTCCAGTAGTGCAC
CAGCTCCTCACCAGGTACTTGAAGCAATTTCACCTTACGCCCGTCATGAGCCAGGAGGAGGTGGAGCACT
GGTTCTACCCCCAGGAGAATATCATCGACACTTTCGTGGTGGAGAACGCAAACGGAGAGGTGACAGATTT
CCTGAGCTTTTATACGCTGCCCTCCACCATCATGAACCATCCAACCCACAAGAGTCTCAAAGCTGCTTAT
TCTTTCTACAACGTTCACACCCAGACCCCTCTTCTAGACCTCATGAGCGACGCCCTTGTCCTCGCCAAAA
TGAAAGGGTTTGATGTGTTCAATGCACTGGATCTCATGGAGAACAAAACCTTCCTGGAGAAGCTCAAGTT
TGGCATAGGGGACGGCAACCTGCAGTATTACCTTTACAATTGGAAATGCCCCAGCATGGGGGCAGAGAAG
GTTGGACTGGTGCTACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200594 representing NM_021079
Red=Cloning site Green=Tags(s)

MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSE
TDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEP
DKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQW
HCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAV
YTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH
QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEK
VGLVLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021079
ORF Size 1488 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021079.5
RefSeq Size 4903 bp
RefSeq ORF 1491 bp
Locus ID 4836
UniProt ID P30419
Cytogenetics 17q21.31
Domains NMT
Protein Families Druggable Genome
MW 56.6 kDa
Gene Summary Myristate, a rare 14-carbon saturated fatty acid, is cotranslationally attached by an amide linkage to the N-terminal glycine residue of cellular and viral proteins with diverse functions. N-myristoyltransferase (NMT; EC 2.3.1.97) catalyzes the transfer of myristate from CoA to proteins. N-myristoylation appears to be irreversible and is required for full expression of the biologic activities of several N-myristoylated proteins, including the alpha subunit of the signal-transducing guanine nucleotide-binding protein (G protein) GO (GNAO1; MIM 139311) (Duronio et al., 1992 [PubMed 1570339]).[supplied by OMIM, Nov 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.