PAPSS2 (NM_004670) Human Tagged ORF Clone

CAT#: RC200551

Reviews ()
Write a review

PAPSS2 (Myc-DDK-tagged)-Human 3'-phosphoadenosine 5'-phosphosulfate synthase 2 (PAPSS2), transcript variant 1



  "NM_004670" in other vectors (5)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PAPSS2
Synonyms ATPSK2; BCYM4; SK2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200551 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGGATCAAGAAGCAAAAGACGGAGAACCAGCAGAAATCCACCAATGTAGTCTATCAGGCCCACC
ATGTGAGCAGGAATAAGAGAGGGCAAGTGGTTGGAACAAGGGGTGGGTTCCGAGGATGTACCGTGTGGCT
AACAGGTCTCTCTGGTGCTGGAAAAACAACGATAAGTTTTGCCCTGGAGGAGTACCTTGTCTCCCATGCC
ATCCCTTGTTACTCCCTGGATGGGGACAATGTCCGTCATGGCCTTAACAGAAATCTCGGATTCTCTCCTG
GGGACAGAGAGGAAAATATCCGCCGGATTGCTGAGGTGGCTAAGCTGTTTGCTGATGCTGGTCTGGTCTG
CATTACCAGCTTTATTTCTCCATTCGCAAAGGATCGTGAGAATGCCCGCAAAATACATGAATCAGCAGGG
CTGCCATTCTTTGAAATATTTGTAGATGCACCTCTAAATATTTGTGAAAGCAGAGACGTAAAAGGCCTCT
ATAAAAGGGCCAGAGCTGGGGAGATTAAAGGATTTACAGGTATTGATTCTGATTATGAGAAACCTGAAAC
TCCTGAGCGTGTGCTTAAAACCAATTTGTCCACAGTGAGTGACTGTGTCCACCAGGTAGTGGAACTTCTG
CAAGAGCAGAACATTGTACCCTATACTATAATCAAAGATATCCACGAACTCTTTGTGCCGGAAAACAAAC
TTGACCACGTCCGAGCTGAGGCTGAAACTCTCCCTTCATTATCAATTACTAAGCTGGATCTCCAGTGGGT
CCAGGTTTTGAGCGAAGGCTGGGCCACTCCCCTCAAAGGTTTCATGCGGGAGAAGGAGTACTTACAGGTT
ATGCACTTTGACACCCTGCTAGATGATGGCGTGATCAACATGAGCATCCCCATTGTACTGCCCGTCTCTG
CAGAGGATAAGACACGGCTGGAAGGGTGCAGCAAGTTTGTCCTGGCACATGGTGGACGGAGGGTAGCTAT
CTTACGAGACGCTGAATTCTATGAACACAGAAAAGAGGAACGCTGTTCCCGTGTTTGGGGGACAACATGT
ACAAAACACCCCCATATCAAAATGGTGATGGAAAGTGGGGACTGGCTGGTTGGTGGAGACCTTCAGGTGC
TGGAGAAAATAAGATGGAATGATGGGCTGGACCAATACCGTCTGACACCTCTGGAGCTCAAACAGAAATG
TAAAGAAATGAATGCTGATGCGGTGTTTGCATTCCAGTTGCGCAATCCTGTCCACAATGGCCATGCCCTG
TTGATGCAGGACACTCGCCGCAGGCTCCTAGAGAGGGGCTACAAGCACCCGGTCCTCCTACTACACCCTC
TGGGCGGCTGGACCAAGGATGACGATGTGCCTCTAGACTGGCGGATGAAGCAGCACGCGGCTGTGCTCGA
GGAAGGGGTCCTGGATCCCAAGTCAACCATTGTTGCCATCTTTCCGTCTCCCATGTTATATGCTGGCCCC
ACAGAGGTCCAGTGGCACTGCAGGTCCCGGATGATTGCGGGTGCCAATTTCTACATTGTGGGGAGGGACC
CTGCAGGAATGCCCCATCCTGAAACCAAGAAGGATCTGTATGAACCCACTCATGGGGGCAAGGTCTTGAG
CATGGCCCCTGGCCTCACCTCTGTGGAAATCATTCCATTCCGAGTGGCTGCCTACAACAAAGCCAAAAAA
GCCATGGACTTCTATGATCCAGCAAGGCACAATGAGTTTGACTTCATCTCAGGAACTCGAATGAGGAAGC
TCGCCCGGGAAGGAGAGAATCCCCCAGATGGCTTCATGGCCCCCAAAGCATGGAAGGTCCTGACAGATTA
TTACAGGTCCCTGGAGAAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200551 protein sequence
Red=Cloning site Green=Tags(s)

MSGIKKQKTENQQKSTNVVYQAHHVSRNKRGQVVGTRGGFRGCTVWLTGLSGAGKTTISFALEEYLVSHA
IPCYSLDGDNVRHGLNRNLGFSPGDREENIRRIAEVAKLFADAGLVCITSFISPFAKDRENARKIHESAG
LPFFEIFVDAPLNICESRDVKGLYKRARAGEIKGFTGIDSDYEKPETPERVLKTNLSTVSDCVHQVVELL
QEQNIVPYTIIKDIHELFVPENKLDHVRAEAETLPSLSITKLDLQWVQVLSEGWATPLKGFMREKEYLQV
MHFDTLLDDGVINMSIPIVLPVSAEDKTRLEGCSKFVLAHGGRRVAILRDAEFYEHRKEERCSRVWGTTC
TKHPHIKMVMESGDWLVGGDLQVLEKIRWNDGLDQYRLTPLELKQKCKEMNADAVFAFQLRNPVHNGHAL
LMQDTRRRLLERGYKHPVLLLHPLGGWTKDDDVPLDWRMKQHAAVLEEGVLDPKSTIVAIFPSPMLYAGP
TEVQWHCRSRMIAGANFYIVGRDPAGMPHPETKKDLYEPTHGGKVLSMAPGLTSVEIIPFRVAAYNKAKK
AMDFYDPARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004670
ORF Size 1842 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004670.4
RefSeq Size 3859 bp
RefSeq ORF 1845 bp
Locus ID 9060
UniProt ID O95340
Cytogenetics 10q23.2-q23.31
Domains ATP-sulfurylase, APS_kinase
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism, Selenoamino acid metabolism, Sulfur metabolism
MW 69.5 kDa
Gene Summary Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "PAPSS2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
    • 100 ul

USD 417.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.