SSRP1 (NM_003146) Human Tagged ORF Clone

CAT#: RC200414

Reviews ()
Write a review

SSRP1 (Myc-DDK-tagged)-Human structure specific recognition protein 1 (SSRP1)



Reconstitution Protocol

USD 974.00

USD 1,460.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SSRP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SSRP1
Synonyms FACT; FACT80; T160
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200414 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGACACTGGAGTTCAACGACGTCTATCAGGAGGTGAAAGGTTCCATGAATGATGGTCGACTGA
GGTTGAGCCGTCAGGGCATCATCTTCAAGAATAGCAAGACAGGCAAAGTGGACAACATCCAGGCTGGGGA
GTTAACAGAAGGTATCTGGCGCCGTGTTGCTCTGGGCCATGGACTTAAACTGCTTACAAAGAATGGCCAT
GTCTACAAGTATGATGGCTTCCGAGAATCGGAGTTTGAGAAACTCTCTGATTTCTTCAAAACTCACTATC
GCCTTGAGCTAATGGAGAAGGACCTTTGTGTGAAGGGCTGGAACTGGGGGACAGTGAAATTTGGTGGGCA
GCTGCTTTCCTTTGACATTGGTGACCAGCCAGTCTTTGAGATACCCCTCAGCAATGTGTCCCAGTGCACC
ACAGGCAAGAATGAGGTGACACTGGAATTCCACCAAAACGATGACGCAGAGGTGTCTCTCATGGAGGTGC
GCTTCTACGTCCCACCCACCCAGGAGGATGGTGTGGACCCTGTTGAGGCCTTTGCCCAGAATGTGTTGTC
AAAGGCGGATGTAATCCAGGCCACGGGAGATGCCATCTGCATCTTCCGGGAGCTGCAGTGTCTGACTCCT
CGTGGTCGTTATGACATTCGGATCTACCCCACCTTTCTGCACCTGCATGGCAAGACCTTTGACTACAAGA
TCCCCTACACCACAGTACTGCGTCTGTTTTTGTTACCCCACAAGGACCAGCGCCAGATGTTCTTTGTGAT
CAGCCTGGATCCCCCAATCAAGCAAGGCCAAACTCGCTACCACTTCCTGATCCTCCTCTTCTCCAAGGAC
GAGGACATTTCGTTGACTCTGAACATGAACGAGGAAGAAGTGGAGAAGCGCTTTGAGGGTCGGCTCACCA
AGAACATGTCAGGATCCCTCTATGAGATGGTCAGCCGGGTCATGAAAGCACTGGTAAACCGCAAGATCAC
AGTGCCAGGCAACTTCCAAGGGCACTCAGGGGCCCAGTGCATTACCTGTTCCTACAAGGCAAGCTCAGGA
CTGCTCTACCCGCTGGAGCGGGGCTTCATCTACGTCCACAAGCCACCTGTGCACATCCGCTTCGATGAGA
TCTCCTTTGTCAACTTTGCTCGTGGTACCACTACTACTCGTTCCTTTGACTTTGAAATTGAGACCAAGCA
GGGCACTCAGTATACCTTCAGCAGCATTGAGAGGGAGGAGTACGGGAAACTGTTTGATTTTGTCAACGCG
AAAAAGCTCAACATCAAAAACCGAGGATTGAAAGAGGGCATGAACCCAAGCTACGATGAATATGCTGACT
CTGATGAGGACCAGCATGATGCCTACTTGGAGAGGATGAAGGAGGAAGGCAAGATCCGGGAGGAGAATGC
CAATGACAGCAGCGATGACTCAGGAGAAGAAACCGATGAGTCATTCAACCCAGGTGAAGAGGAGGAAGAT
GTGGCAGAGGAGTTTGACAGCAACGCCTCTGCCAGCTCCTCCAGTAATGAGGGTGACAGTGACCGGGATG
AGAAGAAGCGGAAACAGCTCAAAAAGGCCAAGATGGCCAAGGACCGCAAGAGCCGCAAGAAGCCTGTGGA
GGTGAAGAAGGGCAAAGACCCCAATGCCCCCAAGAGGCCCATGTCTGCATACATGCTGTGGCTCAATGCC
AGCCGAGAGAAGATCAAGTCAGACCATCCTGGCATCAGCATCACGGATCTTTCCAAGAAGGCAGGCGAGA
TCTGGAAGGGAATGTCCAAAGAGAAGAAAGAGGAGTGGGATCGCAAGGCTGAGGATGCCAGGAGGGACTA
TGAAAAAGCCATGAAAGAATATGAAGGGGGCCGAGGCGAGTCTTCTAAGAGGGACAAGTCAAAGAAGAAG
AAGAAAGTAAAGGTAAAGATGGAAAAGAAATCCACGCCCTCTAGGGGCTCATCATCCAAGTCGTCCTCAA
GGCAGCTAAGCGAGAGCTTCAAGAGCAAAGAGTTTGTGTCTAGTGATGAGAGCTCTTCGGGAGAGAACAA
GAGCAAAAAGAAGAGGAGGAGGAGCGAGGACTCTGAAGAAGAAGAACTAGCCAGTACTCCCCCCAGCTCA
GAGGACTCAGCGTCAGGATCCGATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200414 protein sequence
Red=Cloning site Green=Tags(s)

MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKLLTKNGH
VYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCT
TGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAICIFRELQCLTP
RGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKD
EDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSG
LLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEED
VAEEFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRPMSAYMLWLNA
SREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKK
KKVKVKMEKKSTPSRGSSSKSSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSS
EDSASGSDE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003146
ORF Size 2127 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003146.3
RefSeq Size 2825 bp
RefSeq ORF 2130 bp
Locus ID 6749
UniProt ID Q08945
Cytogenetics 11q12.1
Domains HMG, SSrecog
Protein Families Transcription Factors
MW 81.1 kDa
Gene Summary The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.