Sumo 3 (SUMO3) (NM_006936) Human Tagged ORF Clone

CAT#: RC200241

SUMO3 (Myc-DDK-tagged)-Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3)

Product Images

Circular map for RC200241

• 

  Western blot validation of overexpression lysate (Cat# LY402068) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200241 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified SUMO3 protein (Cat# TP300241). The protein was produced from HEK293T cells transfected with SUMO3 cDNA clone (Cat# RC200241) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Sumo 3
• Synonyms: SMT3A; Smt3B; SMT3H1; SUMO-3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200241 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCGAGGAGAAGCCCAAGGAGGGTGTGAAGACAGAGAATGACCACATCAACCTGAAGGTGGCCGGGC
  AGGACGGCTCCGTGGTGCAGTTCAAGATCAAGAGGCACACGCCGCTGAGCAAGCTGATGAAGGCCTACTG
  CGAGAGGCAGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGACGGGCAGCCAATCAATGAAACTGAC
  ACTCCAGCACAGCTGGAGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGTGTGC
  CGGAGAGCAGCCTGGCAGGGCACAGTTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200241 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD
  TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_006936
• ORF Size: 309 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_006936.3
• RefSeq Size: 1831 bp
• RefSeq ORF: 312 bp
• Locus ID: 6612
• UniProt ID: P55854
• Cytogenetics: 21q22.3
• Domains: UBQ
• Protein Families: Druggable Genome
• MW: 11.6 kDa
• Gene Summary: This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]