Sumo 3 (SUMO3) (NM_006936) Human Tagged ORF Clone
CAT#: RC200241
SUMO3 (Myc-DDK-tagged)-Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_006936" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Sumo 3 |
Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200241 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCGAGGAGAAGCCCAAGGAGGGTGTGAAGACAGAGAATGACCACATCAACCTGAAGGTGGCCGGGC AGGACGGCTCCGTGGTGCAGTTCAAGATCAAGAGGCACACGCCGCTGAGCAAGCTGATGAAGGCCTACTG CGAGAGGCAGGGCTTGTCAATGAGGCAGATCAGATTCAGGTTCGACGGGCAGCCAATCAATGAAACTGAC ACTCCAGCACAGCTGGAGATGGAGGACGAGGACACCATCGACGTGTTCCAGCAGCAGACGGGAGGTGTGC CGGAGAGCAGCCTGGCAGGGCACAGTTTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200241 protein sequence
Red=Cloning site Green=Tags(s) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006936 |
ORF Size | 309 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006936.3 |
RefSeq Size | 1831 bp |
RefSeq ORF | 312 bp |
Locus ID | 6612 |
UniProt ID | P55854 |
Cytogenetics | 21q22.3 |
Domains | UBQ |
Protein Families | Druggable Genome |
MW | 11.6 kDa |
Gene Summary | This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200241L1 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), Myc-DDK-tagged |
USD 450.00 |
|
RC200241L2 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), mGFP tagged |
USD 450.00 |
|
RC200241L3 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), Myc-DDK-tagged |
USD 450.00 |
|
RC200241L4 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), mGFP tagged |
USD 450.00 |
|
RG200241 | SUMO3 (tGFP-tagged) - Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
USD 350.00 |
|
SC115792 | SUMO3 (untagged)-Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review