LMCD1 (NM_014583) Human Tagged ORF Clone

CAT#: RC200062

Reviews ()
Write a review

LMCD1 (Myc-DDK-tagged)-Human LIM and cysteine-rich domains 1 (LMCD1)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LMCD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200062 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAAGGTGGCTAAGGACCTCAACCCAGGAGTTAAAAAGATGTCCCTGGGCCAGCTGCAGTCAGCAA
GAGGTGTGGCATGTTTGGGATGCAAGGGGACGTGTTCGGGCTTCGAGCCACATTCATGGAGGAAAATATG
CAAGTCTTGCAAATGCAGCCAAGAGGACCACTGCCTAACATCTGACCTAGAAGACGATCGGAAAATTGGC
CGCTTGCTGATGGACTCCAAGTATTCCACCCTCACTGCTCGGGTGAAAGGCGGGGACGGCATCCGGATTT
ACAAGAGGAACCGGATGATCATGACCAACCCTATTGCTACTGGGAAAGATCCCACTTTTGACACCATCAC
CTACGAGTGGGCTCCCCCTGGAGTCACCCAGAAACTGGGACTGCAGTACATGGAGCTCATCCCCAAGGAG
AAGCAGCCAGTGACAGGCACAGAGGGTGCCTTTTACCGCCGCCGCCAGCTCATGCACCAGCTCCCCATCT
ATGACCAGGATCCCTCGCGCTGCCGTGGACTTTTGGAGAATGAGTTGAAACTGATGGAAGAATTTGTCAA
GCAATATAAGAGCGAGGCCCTCGGCGTGGGAGAAGTGGCCCTCCCGGGGCAGGGTGGCTTGCCCAAGGAG
GAGGGGAAGCAGCAGGAAAAGCCAGAGGGGGCAGAGACCACTGCTGCTACCACCAACGGCAGTCTCAGTG
ACCCGTCCAAAGAAGTGGAATACGTCTGCGAGCTCTGCAAGGGAGCGGCCCCTCCTGACAGCCCCGTGGT
CTACTCGGACAGGGCAGGCTACAACAAGCAGTGGCACCCCACCTGCTTTGTGTGTGCCAAGTGCTCCGAG
CCGCTGGTGGACCTCATCTACTTCTGGAAGGATGGTGCACCCTGGTGCGGCCGCCATTACTGCGAGAGTC
TGCGGCCCCGGTGCTCCGGCTGCGATGAGATAATATTCGCTGAGGACTACCAGCGTGTGGAAGATCTGGC
CTGGCACCGAAAGCACTTTGTCTGTGAGGGTTGTGAGCAGCTGCTGAGCGGCCGGGCGTACATCGTCACC
AAGGGTCAGCTTCTGTGCCCAACTTGCAGCAAGTCCAAACGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200062 protein sequence
Red=Cloning site Green=Tags(s)

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG
RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE
KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE
EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE
PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT
KGQLLCPTCSKSKRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014583
ORF Size 1095 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014583.4
RefSeq Size 1757 bp
RefSeq ORF 1098 bp
Locus ID 29995
UniProt ID Q9NZU5
Cytogenetics 3p25.3
Domains LIM
MW 40.8 kDa
Gene Summary This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions. The protein may act as a co-regulator of transcription along with other transcription factors. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]
Other products for "LMCD1"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.