LMCD1 (NM_014583) Human Tagged ORF Clone

CAT#: RG200062

Reviews ()
Write a review
  • TrueORF®

LMCD1 (GFP-tagged) - Human LIM and cysteine-rich domains 1 (LMCD1)



  "NM_014583" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 657.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "LMCD1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol LMCD1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200062 representing NM_014583
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAAGGTGGCTAAGGACCTCAACCCAGGAGTTAAAAAGATGTCCCTGGGCCAGCTGCAGTCAGCAA
GAGGTGTGGCATGTTTGGGATGCAAGGGGACGTGTTCGGGCTTCGAGCCACATTCATGGAGGAAAATATG
CAAGTCTTGCAAATGCAGCCAAGAGGACCACTGCCTAACATCTGACCTAGAAGACGATCGGAAAATTGGC
CGCTTGCTGATGGACTCCAAGTATTCCACCCTCACTGCTCGGGTGAAAGGCGGGGACGGCATCCGGATTT
ACAAGAGGAACCGGATGATCATGACCAACCCTATTGCTACTGGGAAAGATCCCACTTTTGACACCATCAC
CTACGAGTGGGCTCCCCCTGGAGTCACCCAGAAACTGGGACTGCAGTACATGGAGCTCATCCCCAAGGAG
AAGCAGCCAGTGACAGGCACAGAGGGTGCCTTTTACCGCCGCCGCCAGCTCATGCACCAGCTCCCCATCT
ATGACCAGGATCCCTCGCGCTGCCGTGGACTTTTGGAGAATGAGTTGAAACTGATGGAAGAATTTGTCAA
GCAATATAAGAGCGAGGCCCTCGGCGTGGGAGAAGTGGCCCTCCCGGGGCAGGGTGGCTTGCCCAAGGAG
GAGGGGAAGCAGCAGGAAAAGCCAGAGGGGGCAGAGACCACTGCTGCTACCACCAACGGCAGTCTCAGTG
ACCCGTCCAAAGAAGTGGAATACGTCTGCGAGCTCTGCAAGGGAGCGGCCCCTCCTGACAGCCCCGTGGT
CTACTCGGACAGGGCAGGCTACAACAAGCAGTGGCACCCCACCTGCTTTGTGTGTGCCAAGTGCTCCGAG
CCGCTGGTGGACCTCATCTACTTCTGGAAGGATGGTGCACCCTGGTGCGGCCGCCATTACTGCGAGAGTC
TGCGGCCCCGGTGCTCCGGCTGCGATGAGATAATATTCGCTGAGGACTACCAGCGTGTGGAAGATCTGGC
CTGGCACCGAAAGCACTTTGTCTGTGAGGGTTGTGAGCAGCTGCTGAGCGGCCGGGCGTACATCGTCACC
AAGGGTCAGCTTCTGTGCCCAACTTGCAGCAAGTCCAAACGCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200062 representing NM_014583
Red=Cloning site Green=Tags(s)

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIG
RLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKE
KQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKE
EGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSE
PLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVT
KGQLLCPTCSKSKRS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014583
ORF Size 1095 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014583.4
RefSeq Size 1754 bp
RefSeq ORF 1098 bp
Locus ID 29995
UniProt ID Q9NZU5
Cytogenetics 3p25.3
Domains LIM
Gene Summary This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions. The protein may act as a co-regulator of transcription along with other transcription factors. Alternate splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Other Versions

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.