Usp15 (NM_001301628) Mouse Tagged ORF Clone

CAT#: MR231419

Reviews ()
Write a review
  • TrueORF®

Usp15 (myc-DDK-tagged) - Mouse ubiquitin specific peptidase 15 (Usp15), transcript variant 2



Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 959.00

5 Weeks*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Usp15"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Usp15
Synonyms 4921514G19Rik; AI327321; E430033I05Rik; Gcap; Gcap18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR231419 representing NM_001301628
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAAGGCGGAGCGGCGGACCTGGACACCCAGCGTTCTGACATCGCGACGCTGCTCAAAACCTCGC
TCCGGAAAGGGGACACCTGGTATCTAGTAGATAGTCGGTGGTTCAAACAGTGGAAAAAATATGTTGGCTT
TGACAGCTGGGACAAATACCAGATGGGAGATCAAAATGTCTATCCTGGACCCATCGATAACTCTGGACTT
CTCAAAGATGGCGACGCGCAGTCACTTAAGGAGCACCTTATTGATGAGTTGGATTACATACTCTTGCCAA
CTGAGGGCTGGAATAAACTTGTCAGCTGGTACACACTGATGGAGGGCCAGGAGCCAATAGCAAGAAAGGT
GGTAGAACAGGGTATGTTTGTAAAGCACTGCAAAGTAGAAGTCTACCTCACAGAACTGAAGCTCTGTGAG
AACGGGAACATGAACAATGTTGTAACTCGGAGGTTTAGCAAAGCTGACACAATAGATACGATTGAGAAGG
AAATAAGAAAAATCTTCAATATTCCAGATGAGAAGGAGGCCAGACTGTGGAACAAGTATATGAGCAACAC
ATTTGAACCACTGAATAAGCCAGACAGCACCATCCAGGATGCCGGCCTATACCAAGGACAGGTGTTAGTG
ATAGAGCAAAAAAATGAAGATGGAACGTGGCCCAGGGGTCCCTCTACTCCTAATGTGAAAAACTCAAATT
ATTGTCTCCCGTCATATACTGCTTATAAGAACTATGATTATTCAGAACCTGGAAGAAACAATGAACAGCC
AGGCCTGTGTGGCTTAAGTAACTTGGGAAATACGTGTTTCATGAACTCAGCCATTCAGTGTTTGAGCAAC
ACACCTCCACTTACTGAATATTTCCTCAATGATAAGTACCAAGAAGAGCTGAATTTTGACAATCCCTTAG
GAATGAGAGGTGAAATAGCTAAATCATACGCTGAACTCATCAAGCAGATGTGGTCTGGAAAGTTTAGCTA
CGTCACTCCAAGAGCATTCAAGACACAGGTAGGGCGCTTCGCACCTCAGTTCTCTGGATATCAACAGCAG
GACTGCCAAGAACTACTGGCTTTCCTGTTGGATGGACTGCACGAGGACCTGAATAGAATTAGGAAAAAAC
CCTATATCCAGTTAAAAGATGCTGATGGCAGGCCAGACAAGGTGGTTGCTGAAGAAGCCTGGGAGAACCA
TTTAAAGCGAAATGATTCCATCATAGTAGACATATTCCATGGCCTTTTCAAGTCTACGTTAGTGTGTCCT
GAGTGTGCTAAGATCTCGGTGACCTTTGACCCTTTCTGTTACTTGACTCTTCCATTGCCTATGAAAAAAG
AACGTAGCTTGGAAGTTTATTTAGTTAGAATGGATCCACTTGCTAAACCTATGCAATACAAAGTTATTGT
GCCCAAAATTGGAAATATACTAGATCTTTGTACAGCGCTGTCTGCTTTGTCGGGAGTACCTGCAGATAAG
ATGATAGTCACTGACATATACAATCATAGATTTCACAGGATATTTGCCGTGGATGAAAACCTGAGTAGTA
TTATGGAGCGGGATGATATTTACGTGTTTGAAATTAACATCAACAGGGCAGAAGACACAGAGCATGTAGT
TATCCCTGTCTGCCTAAGAGAAAAATTCAGACACTCAAGTTACACTCACCACACTGGCTCTTCACTGTTC
GGCCAGCCTTTTCTTATGGCTATACCACGAAACAATACTGAAGATAAACTCTATAATCTTCTACTCTTGA
GAATGTGCCGGTATGTCAAAATGTCTACTGAAACTGAGGAAACAGATGGACACCTACGTTGCTGTGAGGA
CCAGAATATTAATGGGAATGGGCCAAATGGCCTACATGAAGAGGGTTCACCAAGTGAGATGGAAACCGAC
GAGCCAGATGACGAGTCCAGCCAGGATCAAGAGCTTCCCTCAGAGAACGAGAACAGTCAGTCTGAAGATT
CAGTCGGAGGAGATAACGATTCTGAAAATGGATTGTGCACTGAAGAAACATGCAAAGGTCAACTTACGGG
ACACAAAAAGCGCTTGTTTACATTCCAGTTCAACAACTTAGGCAACAATGACATCAACTACATCAAAGAC
GACACCAGTCACATCCGATTCGATGACAGGCAGCTTCGGCTGGACGAAAGATCTTTTCTCGCTTTGGACT
GGGACCCTGACTTGAAGAAGAGATACTTTGATGAGAATGCTGCAGAGGATTTTGAAAAACATGAAAGTGT
GGAATACAAACCTCCAAAAAGGCCCTTTGTGAAGTTAAAAGACTGCATTGAGCTCTTCACCACCAAGGAG
AAGCTGGGTGCTGAGGACCCCTGGTATTGTCCAAATTGTAAAGAGCATCAGCAAGCCACAAAGAAATTAG
ATCTGTGGTCCCTGCCTCCAGTTCTTGTGGTGCATCTCAAGAGATTCTCCTATAGTCGCTACATGAGAGA
CAAGCTAGATACATTAGTCGATTTTCCCATCAGTGACTTGGATATGTCAGAATTCCTAATTAACCCAAAT
GCAGGTCCTTGCCGCTATAATTTGATTGCTGTTTCCAACCACTATGGAGGGATGGGAGGAGGACATTATA
CTGCTTTTGCAAAAAACAAAGATGATGGGAAGTGGTACTATTTCGATGACAGTAGCGTCTCCACTGCATC
TGAAGACCAAATCGTGTCCAAGGCAGCGTACGTGCTCTTCTACCAGAGACAGGACACTTTCAGTGGGACT
GGCTTCTTCCCTCTTGACCGAGAAACTAAAGGTGCTTCAGCTGCCACAGGTATCCCCCTGGAAAGTGACG
AAGACAGCAATGATAATGACAATGACCTAGAAAATGAAAACTGTATGCACACTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR231419 representing NM_001301628
Red=Cloning site Green=Tags(s)

MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGL
LKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCE
NGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKEARLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLV
IEQKNEDGTWPRGPSTPNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFMNSAIQCLSN
TPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPRAFKTQVGRFAPQFSGYQQQ
DCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEEAWENHLKRNDSIIVDIFHGLFKSTLVCP
ECAKISVTFDPFCYLTLPLPMKKERSLEVYLVRMDPLAKPMQYKVIVPKIGNILDLCTALSALSGVPADK
MIVTDIYNHRFHRIFAVDENLSSIMERDDIYVFEININRAEDTEHVVIPVCLREKFRHSSYTHHTGSSLF
GQPFLMAIPRNNTEDKLYNLLLLRMCRYVKMSTETEETDGHLRCCEDQNINGNGPNGLHEEGSPSEMETD
EPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKKRLFTFQFNNLGNNDINYIKD
DTSHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKPPKRPFVKLKDCIELFTTKE
KLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYSRYMRDKLDTLVDFPISDLDMSEFLINPN
AGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGT
GFFPLDRETKGASAATGIPLESDEDSNDNDNDLENENCMHTN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001301628
ORF Size 2856 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001301628.1, NP_001288557.1
RefSeq Size 11477 bp
RefSeq ORF 2859 bp
Locus ID 14479
UniProt ID Q8R5H1
Cytogenetics 10 D2
MW 109.7 kDa
Gene Summary The protein encoded by this gene is a member of the large ubiquitin specific protease (Usp) family of proteins. These proteins are known to cleave ubiquitin, and contain a conserved cysteine residue (Cys box) and two conserved histidine residues (His box) that are thought to form part of the active site of the protease. This protein has been shown to cleave both the ubiquitin-proline and the ubiquitin-methionine bonds in vitro. This protein is thought to regulate many cellular processes through its deubiquitination activity, including the transforming growth factor beta (TGF-beta) pathway. Cardiac-specific overexpression of the human ortholog of this gene in mice causes enlargement of the heart that is more pronounced in the atrium than in the ventricle. This gene has two pseudogenes on chromosome 14. Alternative splicing results in multiple transcript variants that encode multiple protein isoforms.[provided by RefSeq, Aug 2014]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.