Rabbit Polyclonal antibody to USP15 (ubiquitin specific peptidase 15)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 920 and 981 of USP15 (Uniprot ID#Q9Y4E8) |
Rabbit Polyclonal Anti-USP15 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP15 antibody: synthetic peptide directed towards the C terminal of human USP15. Synthetic peptide located within the following region: GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAED |
Rabbit polyclonal anti-USP15 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human USP15. |
USP15 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence from the C Terminus of the protein sequence according to NP_006304.1. |
USP15 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human USP15. |
USP15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP15 |
Germany
Japan
United Kingdom
China
