Nr1i2 (NM_010936) Mouse Tagged ORF Clone

CAT#: MR226044

Reviews ()
Write a review
  • TrueORF®

Nr1i2 (Myc-DDK-tagged) - Mouse nuclear receptor subfamily 1, group I, member 2 (Nr1i2), transcript variant 1



  "NM_010936" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 686.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "Nr1i2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Nr1i2
Synonyms mPXR; PXR; PXR.1; PXR.2; PXR1; SXR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR226044 representing NM_010936
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACCTGAGGAGAGCTGGAGCCGAGTTGGCCTTGTACAGTGTGAAGAAGCAGACTCTGCCTTGGAAG
AGCCCATCAACGTAGAGGAGGAAGATGGAGGTCTTCAAATCTGCCGTGTATGTGGGGACAAGGCCAATGG
CTACCACTTCAATGTCATGACGTGTGAAGGATGCAAGGGGTTTTTCAGAAGGGCCATGAAACGCAATGTC
CGGCTGAGGTGCCCCTTCCGCAAGGGAACCTGCGAGATCACCCGGAAGACACGACGGCAGTGCCAGGCCT
GCCGTTTGCGCAAGTGCCTGGAGAGTGGCATGAAGAAAGAGATGATCATGTCCGATGCCGCTGTGGAGCA
GAGGCGGGCCTTGATCAAGAGGAAGAAGAGGGAAAAGATTGAGGCTCCACCGCCTGGAGGGCAGGGGCTG
ACGGAAGAACAGCAGGCGCTGATCCAGGAGCTGATGGACGCTCAGATGCAAACCTTTGACACAACTTTCT
CCCACTTCAAGGATTTCCGGCTGCCTGCAGTGTTCCACAGTGGCTGTGAGCTTCCAGAGTTTCTGCAGGC
CTCACTGTTGGAAGACCCTGCCACATGGAGTCAAATCATGAAAGACAGGGTTCCAATGAAGATCTCTCTG
CAGCTGCGCGGAGAAGACGGCAGCATCTGGAACTACCAACCCCCTTCCAAGAGCGACGGGAAAGAGATCA
TCCCTCTTCTGCCACACCTGGCCGATGTGTCAACCTACATGTTCAAGGGCGTCATCAACTTCGCCAAAGT
CATATCCTACTTTAGGGACCTGCCTATTGAGGACCAGATCTCCCTGCTGAAGGGGGCCACTTTTGAGATG
TGCATCCTGAGGTTCAACACGATGTTCGACACGGAAACGGGAACCTGGGAGTGCGGCCGGCTGGCTTACT
GCTTCGAAGACCCTAATGGTGGCTTCCAGAAACTTCTGTTGGATCCATTGATGAAATTCCACTGCATGCT
GAAGAAGCTACAGCTGCATAAGGAGGAGTATGTGCTGATGCAGGCCATCTCCCTCTTCTCCCCAGATCGT
CCTGGTGTGGTCCAGCGCAGCGTGGTAGACCAACTGCAGGAGAGGTTTGCCCTCACCCTGAAGGCCTACA
TTGAGTGTAGTCGGCCATATCCTGCTCACAGGTTCCTGTTCCTGAAGATCATGGCCGTCCTCACTGAGCT
GCGAAGCATCAACGCCCAGCAAACCCAGCAGTTGCTGCGCATCCAAGACTCGCACCCCTTTGCCACCCCA
CTCATGCAAGAGTTATTTAGCAGCACAGATGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226044 representing NM_010936
Red=Cloning site Green=Tags(s)

MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNV
RLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGL
TEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSGCELPEFLQASLLEDPATWSQIMKDRVPMKISL
QLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEM
CILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDR
PGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATP
LMQELFSSTDG

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010936
ORF Size 1293 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010936.3, NP_035066.1
RefSeq Size 2540 bp
RefSeq ORF 1296 bp
Locus ID 18171
UniProt ID O54915
Cytogenetics 16 B3
MW 50 kDa
Gene Summary Nuclear receptor that binds and is activated by a variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, endogenous compounds and drugs. Response to specific ligands is species-specific, due to differences in the ligand-binding domain. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes (By similarity). Activated by naturally occurring steroids such as pregnenolone and progesterone, the cholesterol metabolite 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol, synthetic glucocorticoids and antiglucocorticoids and 16-alpha-carbonitrile (PCN).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.