Rbm4 (NM_009032) Mouse Tagged ORF Clone

CAT#: MR223309

  • TrueORF®

Rbm4 (Myc-DDK-tagged) - Mouse RNA binding motif protein 4 (Rbm4)

ORF Plasmid: DDK tGFP

AAV Particle: DDK


  "NM_009032" in other vectors (2)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Rbm4"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Rbm4
Synonyms 4921506I22Rik; lark; Lark1; Mlark; Rbm4a
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR223309 representing NM_009032
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGAAGCTGTTCATTGGAAATCTGCCCCGGGAGGCCACAGAGCAGGAGATCCGCTCACTCTTCGAGC
AGTACGGGAAGGTGCTGGAATGTGACATCATTAAGAATTATGGCTTTGTGCACATAGAGGACAAGACGGC
CGCTGAGGATGCCATACGCAACCTGCACCACTACAAGCTGCACGGAGTGAACATCAATGTGGAAGCCAGC
AAGAATAAGAGCAAAGCTTCAACCAAGTTACACGTGGGCAACATCAGCCCCACTTGTACCAACCAAGAGC
TTCGGGCCAAGTTTGAGGAGTACGGCCCAGTCATCGAATGTGACATCGTGAAAGATTATGCCTTTGTACA
CATGGAGCGGGCAGAGGATGCGGTGGAGGCCATCAGGGGCCTCGACAACACAGAGTTTCAAGGCAAACGA
ATGCACGTGCAGTTGTCCACCAGCCGGCTTAGGACCGCGCCCGGGATGGGAGACCAGAGCGGCTGCTATC
GGTGCGGGAAAGAGGGGCACTGGTCCAAAGAGTGTCCAATAGATCGTTCGGGCCGCGTGGCAGACTTGAC
CGAGCAATATAATGAGCAATATGGAGCAGTGCGTACGCCTTACACCATGAGTTATGGGGATTCATTGTAT
TACAACAACACGTACGGAGCGCTCGATGCCTACTACAAGCGCTGCCGTGCTGCCCGGTCCTATGAGGCAG
TGGCAGCTGCAGCTGCCTCTGCGTATAGTAACTATGCAGAGCAGACTTTGTCTCAGCTGCCACAAGTCCA
GAACACAGCCATGGCCAGTCACCTCACCTCCACCTCTCTCGATCCCTACAATAGACATCTGTTGCCGCCT
TCAGGAGCTGCAGCAGCAGCAGCAGCTGCTGCTGCTTGTACTGCAGCTTCTACTTCATATTACGGGCGGG
ATCGGAGCCCCCTGCGTCGCGCTACAGGCCCAGTCCTCACTGTTGGAGAGGGCTACGGTTACGGGCATGA
CAGTGAGTTGTCCCAAGCTTCAGCAGCTGCTCGGAATTCCCTGTACGACATGGCCCGGTATGAGCGGGAG
CAGTATGCGGATCGGGCGCGGTACTCAGCCTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223309 representing NM_009032
Red=Cloning site Green=Tags(s)

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS
KNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR
MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLY
YNNTYGALDAYYKRCRAARSYEAVAAAAASAYSNYAEQTLSQLPQVQNTAMASHLTSTSLDPYNRHLLPP
SGAAAAAAAAAACTAASTSYYGRDRSPLRRATGPVLTVGEGYGYGHDSELSQASAAARNSLYDMARYERE
QYADRARYSAF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009032
ORF Size 1083 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009032.3, NP_033058.2
RefSeq Size 2630 bp
RefSeq ORF 1086 bp
Locus ID 19653
UniProt ID Q8C7Q4
Cytogenetics 19 A
MW 40 kDa
Gene Summary RNA-binding factor involved in multiple aspects of cellular processes like alternative splicing of pre-mRNA and translation regulation. Modulates alternative 5'-splice site and exon selection. Acts as a muscle cell differentiation-promoting factor. Activates exon skipping of the PTB pre-mRNA during muscle cell differentiation. Antagonizes the activity of the splicing factor PTBP1 to modulate muscle cell-specific exon selection of alpha tropomyosin. Binds to intronic pyrimidine-rich sequence of the TPM1 and MAPT pre-mRNAs. Required for the translational activation of PER1 mRNA in response to circadian clock. Binds directly to the 3' UTR of the PER1 mRNA. Exerts a suppressive activity on Cap-dependent translation via binding to CU-rich responsive elements within the 3' UTR of mRNAs, a process increased under stress conditions or during myocytes differentiation. Recruits EIF4A1 to stimulate IRES-dependent translation initiation in respons to cellular stress. Associates to internal ribosome entry segment (IRES) in target mRNA species under stress conditions. Plays a role for miRNA-guided RNA cleavage and translation suppression by promoting association of AGO2-containing miRNPs with their cognate target mRNAs. Associates with miRNAs during muscle cell differentiation. Binds preferentially to 5'-CGCGCG[GCA]-3' motif in vitro.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.