Ccnb1ip1 (NM_001111119) Mouse Tagged ORF Clone

CAT#: MR222573

  • TrueORF®

Ccnb1ip1 (Myc-DDK-tagged) - Mouse cyclin B1 interacting protein 1 (Ccnb1ip1)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_001111119" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-Ccnb1ip1 Antibody - N-terminal region
    • 100 ul

USD 539.00

Other products for "Ccnb1ip1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ccnb1ip1
Synonyms Gm288; Hei10; mei4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR222573 representing NM_001111119
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTTGTGTGAAGACATGCTGCTTTGCAATTATCGGAAGTGTCGGATCAAGCTCTCTGGTTATGCTT
GGGTCACTGCCTGTTCTCACATCTTCTGCGATCAGCACGGCAGCGGGGAGTTCAGTCGTTCACCAGCGAT
CTGTCCTGCTTGCAACAGTACCCTTTCTGGAAAGCTAGATATTGTTCGAACAGAACTCAGTCCATCAGAG
GAGTACAAAGCTATGGTATTGGCAGGGCTTCGCCCAGAGGTTGTTTTGGACATTAGCTCCCGGGCATTGG
CCTTCTGGACATACCAGGTACACCAGGAGCGTCTCTATCAAGAGTATAATTTCAGCAAGGCCGAGAACCA
CTTAAAACAGATGGAGAAGATGTATATGCAGCAAATACAGAGCAAGAATATAGAATTGACCTCTATGAAA
GGGGAGGTTATTTCCATGAAGAAAGTTCTAGAAGAATACAAGAAAAAGTTTAGTGACATCTCTGAAAAAC
TTATGGAGCGTAATCGCCAGTACCAAAAGCTCCAAGGCCTTTATGATAGCCTTAGGCTAAGAAATATCAC
TATCGCCAGCCAAGAAGGCTCCCTGGAACCAGGTATGATCCCGCAGTCTGGAGTCTTTGGCTTCCCACCA
GGGAATAACTCAAAGTTTTCTTTGGACCATATACCAGTTGGAAATCAAGGTGGTGGAGATGAAGATGTTC
AGTTCAGACCATTTTTTGTGTGTTCTCCCACAGCGCCTGAACCCATTAACAACTTCTTTAGTTTTGCATC
TCCAAGCCATGAAGCAGAGCAGCAAGTCTGCAGCAGGGCCTTTAAAGCAAAAAGAATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR222573 representing NM_001111119
Red=Cloning site Green=Tags(s)

MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSE
EYKAMVLAGLRPEVVLDISSRALAFWTYQVHQERLYQEYNFSKAENHLKQMEKMYMQQIQSKNIELTSMK
GEVISMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIASQEGSLEPGMIPQSGVFGFPP
GNNSKFSLDHIPVGNQGGGDEDVQFRPFFVCSPTAPEPINNFFSFASPSHEAEQQVCSRAFKAKRI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001111119
ORF Size 828 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001111119.1, NP_001104589.1
RefSeq Size 1508 bp
RefSeq ORF 831 bp
Locus ID 239083
UniProt ID D3Z3K2
Cytogenetics 14 C1
MW 31.8 kDa
Gene Summary Ubiquitin E3 ligase that acts as a limiting factor for crossing-over during meiosis: required during zygonema to limit the colocalization of RNF212 with MutS-gamma-associated recombination sites and thereby establish early differentiation of crossover and non-crossover sites. Later, it is directed by MutL-gamma to stably accumulate at designated crossover sites. Probably promotes the dissociation of RNF212 and MutS-gamma to allow the progression of recombination and the implementation of the final steps of crossing over. Modulates cyclin-B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.