Nos1ap (NM_027528) Mouse Tagged ORF Clone

CAT#: MR219444

  • TrueORF®

Nos1ap (Myc-DDK-tagged) - Mouse nitric oxide synthase 1 (neuronal) adaptor protein (Nos1ap), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_027528" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Nos1ap"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Nos1ap
Synonyms 6330408P19Rik; Capon
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR219444 representing NM_027528
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCAGAATCCGGTATGAGTTTAAAGCCAAGAACATCAAGAAGAAGAAAGTAAGCATCATGGTCTCTG
TGGACGGTGTCAAGGTGATTCTGAAGAAGAAGAAAAAGAAAAAGGAGTGGACGTGGGATGAGAGCAAGAT
GCTGGTGATGCAGGACCCTATCTACAGGATCTTCTATGTCTCTCATGACTCCCAAGACTTGAAAATCTTC
AGCTATATTGCCAGAGATGGTGCCAGCAATATCTTCAGATGTAACGTCTTTAAATCCAAAAAGAAGAGTC
AAGCTATGAGAATCGTGCGGACAGTGGGACAGGCCTTCGAAGTCTGCCACAAGCTGAGCCTGCAGCACAC
ACAGCAGAATGCAGATGGCCAGGAAGATGGGGAGAGCGAGAGGAACAGTGATGGCTCAGGAGACCCAGGC
CGGCAGCTCACGGGAGCTGAGAGGGTCTCCACAGCCGCTGCAGAGGAGACAGACATTGACGCCGTGGAGG
TCCCACTCCCTGGGAATGACATTCTGGAATTCAGCCGAGGTGTGACTGATCTGGATGCCGTAGGGAAGGA
TGGAGGCTCCCACATAGACTCAACGGTCTCACCCCACCCTCAGGAGCCCATGCTGACAGCCTCCCCTCGA
ATGCTGCTCCCTTCCTCTTCCTCGAAGCCGCCAGGCTTGGGCACGGGGACGCCCCTGTCCACTCACCACC
AGATGCAGCTCCTCCAGCAGCTCCTCCAGCAGCAGCAACAACAGACACAAGTGGCTGTGGCCCAGGTTCT
CCTCAGCCTCCTCCCTTCTTCACAGGCTCCACTCTCATGGGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR219444 representing NM_027528
Red=Cloning site Green=Tags(s)

MRRIRYEFKAKNIKKKKVSIMVSVDGVKVILKKKKKKKEWTWDESKMLVMQDPIYRIFYVSHDSQDLKIF
SYIARDGASNIFRCNVFKSKKKSQAMRIVRTVGQAFEVCHKLSLQHTQQNADGQEDGESERNSDGSGDPG
RQLTGAERVSTAAAEETDIDAVEVPLPGNDILEFSRGVTDLDAVGKDGGSHIDSTVSPHPQEPMLTASPR
MLLPSSSSKPPGLGTGTPLSTHHQMQLLQQLLQQQQQQTQVAVAQVLLSLLPSSQAPLSWA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_027528
ORF Size 813 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_027528.2, NP_081804.1
RefSeq Size 1533 bp
RefSeq ORF 816 bp
Locus ID 70729
Cytogenetics 1 H3
MW 30.5 kDa
Gene Summary Adapter protein involved in neuronal nitric-oxide (NO) synthesis regulation via its association with nNOS/NOS1. The complex formed with NOS1 and synapsins is necessary for specific NO and synapsin functions at a presynaptic level. Mediates an indirect interaction between NOS1 and RASD1 leading to enhance the ability of NOS1 to activate RASD1. Competes with DLG4 for interaction with NOS1, possibly affecting NOS1 activity by regulating the interaction between NOS1 and DLG4 (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.