Epas1 (NM_010137) Mouse Tagged ORF Clone

CAT#: MR211029

Epas1 (Myc-DDK-tagged) - Mouse endothelial PAS domain protein 1 (Epas1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 689.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Epas1 (NM_010137) Mouse Tagged ORF Clone
Symbol Epas1
Synonyms bHLHe73; HIF-2alpha; HIF2A; HLF; HRF; MOP2
Vector pCMV6-Entry
Sequence Data
>MR211029 representing NM_010137
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGCTGACAAGGAGAAAAAAAGGAGCAGCTCAGAGCTGAGGAAGGAGAAATCCCGTGATGCCGCGA
GGTGCCGGCGCAGCAAGGAGACGGAGGTCTTCTATGAGTTGGCTCATGAGTTGCCCCTGCCTCACAGTGT
GAGCTCCCACCTGGACAAAGCCTCCATCATGCGCCTGGCCATCAGCTTCCTTCGGACACATAAGCTCCTG
TCCTCAGTCTGCTCTGAAAATGAATCTGAAGCTGAGGCCGACCAGCAAATGGATAACTTGTACCTGAAAG
CCTTGGAGGGTTTCATTGCTGTGGTGACCCAAGACGGTGACATGATCTTTCTGTCGGAAAACATCAGCAA
GTTCATGGGACTTACTCAGGTAGAACTAACAGGACACAGCATCTTTGACTTCACTCATCCTTGCGACCAT
GAGGAGATCCGTGAGAACCTGACTCTCAAAAACGGCTCTGGTTTTGGGAAGAAGAGCAAAGACGTGTCCA
CCGAGCGTGACTTCTTCATGAGGATGAAGTGCACGGTCACCAACAGAGGCCGGACTGTCAACCTCAAGTC
GGCCACCTGGAAGGTCCTGCACTGCACCGGGCAAGTGAGAGTCTACAACAACTGCCCCCCTCACAGTAGC
CTCTGTGGCTCCAAGGAGCCCCTGCTGTCCTGCCTTATCATCATGTGTGAGCCAATCCAGCACCCATCCC
ACATGGACATCCCCCTGGACAGCAAGACTTTCCTGAGCCGCCACAGCATGGACATGAAGTTCACCTACTG
TGACGACAGAATCTTGGAACTGATTGGTTACCACCCCGAGGAGCTACTTGGACGCTCTGCCTATGAGTTC
TACCATGCCCTGGATTCGGAGAACATGACCAAAAGTCACCAGAACTTGTGCACCAAGGGGCAGGTGGTAT
CTGGCCAGTACCGGATGCTAGCCAAACACGGAGGATATGTGTGGCTGGAGACCCAGGGGACGGTCATCTA
CAACCCCCGCAACCTGCAGCCTCAGTGTATCATGTGTGTCAACTATGTGCTGAGTGAGATCGAGAAGAAC
GACGTGGTGTTCTCCATGGACCAGACCGAATCCCTGTTCAAGCCACACCTGATGGCCATGAACAGCATCT
TTGACAGCAGTGACGATGTGGCTGTAACTGAGAAGAGCAACTACCTGTTCACCAAACTGAAGGAGGAGCC
CGAGGAACTGGCCCAGTTGGCCCCCACCCCAGGAGATGCCATTATTTCTCTCGATTTCGGAAGCCAGAAC
TTCGATGAACCCTCAGCCTATGGCAAGGCCATCCTTCCCCCGGGCCAGCCATGGGTCTCGGGGCTGAGGA
GCCACAGTGCCCAGAGCGAGTCCGGGAGCCTGCCAGCCTTCACTGTGCCCCAGGCAGACACCCCAGGGAA
CACTACACCCAGTGCTTCAAGCAGCAGTAGCTGCTCCACGCCCAGCAGCCCTGAGGACTACTATTCATCC
TTGGAGAATCCCTTGAAGATCGAAGTGATTGAGAAGCTTTTCGCCATGGACACGGAGCCGAGGGACCCGG
GCAGTACCCAGACGGACTTCAGTGAACTGGATTTGGAGACCTTGGCACCCTACATCCCTATGGACGGCGA
GGACTTCCAGCTGAGCCCCATCTGCCCAGAGGAGCCGCTCATGCCAGAGAGCCCCCAGCCCACCCCCCAG
CACTGCTTCAGTACCATGACCAGCATCTTCCAGCCGCTCACCCCGGGGGCCACCCACGGCCCCTTCTTCC
TCGATAAGTACCCGCAGCAGTTGGAAAGCAGGAAGACAGAGTCTGAGCACTGGCCCATGTCTTCCATCTT
CTTTGATGCTGGGAGCAAAGGGTCCCTGTCTCCATGCTGTGGCCAGGCCAGCACCCCTCTCTCTTCTATG
GGAGGCAGATCCAACACGCAGTGGCCCCCGGATCCACCATTACATTTCGGCCCTACTAAGTGGCCTGTGG
GTGATCAGAGTGCTGAATCCCTGGGAGCCCTGCCGGTGGGGTCATCGCAGTTGGAACCTCCGAGCGCCCC
GCCTCATGTCTCCATGTTCAAGATGAGGTCTGCAAAGGACTTCGGGGCCCGAGGTCCATACATGATGAGC
CCAGCCATGATCGCCCTGTCCAACAAGCTGAAGCTAAAGCGGCAGCTGGAGTATGAGGAGCAAGCCTTCC
AAGACACAAGCGGGGGGGACCCTCCAGGCACCAGCAGTTCACACTTGATGTGGAAACGTATGAAGAGCCT
CATGGGCGGGACCTGTCCTTTGATGCCTGACAAGACCATCAGTGCGAACATGGCCCCCGATGAATTCACC
CAAAAATCTATGAGAGGCCTGGGCCAGCCACTGAGACACCTGCCACCTCCCCAGCCACCATCTACCAGGA
GCTCAGGGGAGAACGCCAAGACTGGGTTCCCGCCACAGTGCTATGCCTCCCAGTTCCAGGACTACGGTCC
TCCAGGAGCTCAAAAGGTGTCAGGCGTGGCCAGTCGACTGCTGGGGCCATCGTTCGAGCCTTACCTGTTG
CCGGAACTGACCAGATATGACTGTGAGGTGAACGTGCCCGTGCCTGGAAGCTCCACACTCCTGCAGGGGA
GAGACCTTCTCAGAGCTCTGGACCAGGCCACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR211029 representing NM_010137
Red=Cloning site Green=Tags(s)

MTADKEKKRSSSELRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLL
SSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDH
EEIRENLTLKNGSGFGKKSKDVSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVRVYNNCPPHSS
LCGSKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRILELIGYHPEELLGRSAYEF
YHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN
DVVFSMDQTESLFKPHLMAMNSIFDSSDDVAVTEKSNYLFTKLKEEPEELAQLAPTPGDAIISLDFGSQN
FDEPSAYGKAILPPGQPWVSGLRSHSAQSESGSLPAFTVPQADTPGNTTPSASSSSSCSTPSSPEDYYSS
LENPLKIEVIEKLFAMDTEPRDPGSTQTDFSELDLETLAPYIPMDGEDFQLSPICPEEPLMPESPQPTPQ
HCFSTMTSIFQPLTPGATHGPFFLDKYPQQLESRKTESEHWPMSSIFFDAGSKGSLSPCCGQASTPLSSM
GGRSNTQWPPDPPLHFGPTKWPVGDQSAESLGALPVGSSQLEPPSAPPHVSMFKMRSAKDFGARGPYMMS
PAMIALSNKLKLKRQLEYEEQAFQDTSGGDPPGTSSSHLMWKRMKSLMGGTCPLMPDKTISANMAPDEFT
QKSMRGLGQPLRHLPPPQPPSTRSSGENAKTGFPPQCYASQFQDYGPPGAQKVSGVASRLLGPSFEPYLL
PELTRYDCEVNVPVPGSSTLLQGRDLLRALDQAT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010137
ORF Size 2622 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010137.2, NM_010137.3, NP_034267
RefSeq Size 5352
RefSeq ORF 2625
Locus ID 13819
Cytogenetics 17|17 E4
MW 97.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)