Cast (BC010603) Mouse Tagged ORF Clone

CAT#: MR209946

Cast (Myc-DDK-tagged) - Mouse calpastatin (cDNA clone MGC:12116 IMAGE:3710078)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 880.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cast (BC010603) Mouse Tagged ORF Clone
Symbol Cast
Vector pCMV6-Entry
Sequence Data
>MR209946 representing BC010603
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTACCACAGAGACTAAGGCTGTGAAAACAGAGTCTAAGAAACCACAATCAAGTGAGCAACCTGTGG
TTCACGAGAAAAAGTCAAAAGGAGGGCCAAAGGAAGGGTCAGAGCCCAAAAATCTTCCGAAGCACACATC
AAGTACAGGAAGCAAGCATGCTCATAAAGAAAAAGCACTTTCCAGATCAAATGAACAGATGGTGTCAGAG
AAACCATCAGAATCAAAGACAAAATTTCAAGATGTTCCTTCAGCTGGTGGAGAGAGTGTGGCTGGAGGTG
GGACTGTGGCCACTGCCTTGGACAAAGTGGTTGGTAAGAAAAAAGAACAGAAACCATTCACACCAGCTTC
ACCTGTGCAGTCCACACCGAGCAAGCCATCTGACAAGTCAGGCATGGATGCTGCCTTGGATGACCTGATA
GACACCTTAGGTGGACATGAAGATACTAACAGAGATGATCCACCATATACTGGACCAGTAGTTTTGGACC
CAATGTATTCTACCTACCTTGAGGCACTGGGTATAAAAGAAGGGACTATTCCTCCAGAGTATAGGAAACT
TTTGGAAAAAAATGAAGGGATCACACAACCTCTTCCAGACTCTCCTAAACCTATGGGGACTGACCAGGCT
ATAGATGCCTTGTCATCTGATTTCACCTGTAGTTCTCCAACTGGAAAGCAAAGTGAGAAAGAGAAGTCTA
CTGGGGAAATTTTCAAAGCTCAGTCTGCAGGAGTGACCAGAAGTTCTGTTCCCCCCAAGGAGAAGAAAAG
GAAGGTGGAAGAGGAGGTCATAAATGATCAAGCACTTCAGGCTCTGTCAGATTCACTGGGCACCCGGCAG
CCAGATCCTCCGAGCCACGTTAGCCAAGCTGAACAAGTCAAAGAGGCAAAAGCAAAAGAAGAAAGGCAGG
AGAAGTGTGGTGAAGATGAGGACACAGTCCCAGCTGAGTACAGGTTAAAACCAGCAAAGGATAAAGATGG
AAAACCACTATTGCCAGAGCCTGAAGAAACATCTAAGAGCCTGAGTGAGTCGGAGCTGATTGGGGAGCTT
TCAGCAGATTTTGACCGATCTACATATCAAGACAAACCATCTACGCCAGCTGAAAAGAAATCCAATGACA
CATCCCAAACTCCTCCGGGGGAGACTGTGCCTCGGGCCTCCATGTGCAGTATACGGTCAGCGCCACCCAA
ACTAGCATCCTTGAAGGGCGTGGTACCAGAAGATGCTGTTGAAACCTTGGCTGGAAGCCTGGGGACAAGG
GAAGCAGATCCAGAACATGAAAAAACTGTGGAGGATAAAGTCAAGGAGAAAGCTAAAGAAGAAGAGCATG
AAAAACTTGGTGAAAAAGAAGAAACAGTGCCTCCTGATTATCGACTAGAAGAAGTCAAGGATAAGGATGG
AAAACCACTCCTGCCCAAAGAATCCCAGGAACAACTTGCACCCTTAAGCGATGACTTCCTTCTTGATGCC
TTGTCTCAGGACTTCTCCAGTCCGGCAAACATATCGTCTCTTGAATTTGAAGATGCCAAACTTTCTGCTG
CCATTTCTGAAGTAGTTTCTCAGACACCTGCTCCAAGCACCCATGCAGCAGCTCCACTGCCTGGCACTGA
GCAGAAAGACAAAGAACTTGATGATGCCTTGGATGAACTTTCTGACAGTCTTGGACAAAGGCCGCCTGAT
CCAGATGAGAACAAACCACTGGATGACAAAGTGAAGGAGAAAATCAAACCAGAGCATAGCGAGAAACTGG
GAGAAAGAGACGACACCATCCCCCCTGAATACAGGCATCTCTTGGATAATGATGGGAAGAAACCTGATCA
GGACCGGGACCCCATTGATGCCCTCTCAGAAGATTTGGATAGCTGCCCCTCAACTACAGAGACCTCAAAG
AATACAGCAAAGGGGAAGAGCAAGAAGACTTCAAGTTCCAAAGCATCCAAGGACGGAGAGAAAACAAAGG
ACTCTTCCAAGAAGACAGAGGAAGTGTCCAAGCCAAAGGCTAAAGAAGATGCAAGACACAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209946 representing BC010603
Red=Cloning site Green=Tags(s)

MSTTETKAVKTESKKPQSSEQPVVHEKKSKGGPKEGSEPKNLPKHTSSTGSKHAHKEKALSRSNEQMVSE
KPSESKTKFQDVPSAGGESVAGGGTVATALDKVVGKKKEQKPFTPASPVQSTPSKPSDKSGMDAALDDLI
DTLGGHEDTNRDDPPYTGPVVLDPMYSTYLEALGIKEGTIPPEYRKLLEKNEGITQPLPDSPKPMGTDQA
IDALSSDFTCSSPTGKQSEKEKSTGEIFKAQSAGVTRSSVPPKEKKRKVEEEVINDQALQALSDSLGTRQ
PDPPSHVSQAEQVKEAKAKEERQEKCGEDEDTVPAEYRLKPAKDKDGKPLLPEPEETSKSLSESELIGEL
SADFDRSTYQDKPSTPAEKKSNDTSQTPPGETVPRASMCSIRSAPPKLASLKGVVPEDAVETLAGSLGTR
EADPEHEKTVEDKVKEKAKEEEHEKLGEKEETVPPDYRLEEVKDKDGKPLLPKESQEQLAPLSDDFLLDA
LSQDFSSPANISSLEFEDAKLSAAISEVVSQTPAPSTHAAAPLPGTEQKDKELDDALDELSDSLGQRPPD
PDENKPLDDKVKEKIKPEHSEKLGERDDTIPPEYRHLLDNDGKKPDQDRDPIDALSEDLDSCPSTTETSK
NTAKGKSKKTSSSKASKDGEKTKDSSKKTEEVSKPKAKEDARHS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC010603
ORF Size 2022 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC010603
RefSeq Size 2712
RefSeq ORF 2024
Locus ID 12380
Cytogenetics 13|13 C1
MW 99.4 kDa
Gene Summary This gene encodes an inhibitor of the calcium-dependent cysteine protease, calpain. This protein plays roles in multiple processes, including apoptosis, cell cycle regulation, and membrane fusion. Multiple protein isoforms exist which contain unique N-terminal domains, and multiple inhibitory domains that share homology with each other. Some isoforms may be tissue-specific. Two different pseudogenes of this gene are found on chromosome 19. [provided by RefSeq, Jul 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)