Pafah1b1 (BC026141) Mouse Tagged ORF Clone

CAT#: MR206439

  • TrueORF®

Pafah1b1 (Myc-DDK-tagged) - Mouse platelet-activating factor acetylhydrolase, isoform 1b, beta1 subunit (cDNA clone MGC:13913 IMAGE:4017963)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "BC026141" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Goat Polyclonal Antibody against PAFAH1B1
    • 100 ug

USD 520.00

Other products for "Pafah1b1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Pafah1b1
Synonyms Lis1, LIS-1, MGC25297, MMS10-U, Ms10u
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR206439 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCTGTCCCAGAGACAACGAGATGAACTAAATCGAGCTATAGCAGATTATCTTCGTTCAAATGGCT
ATGAAGAGGCATATTCCGTTTTTAAAAAGGAAGCTGAACTAGATATGAATGAAGAATTAGATAAGAAGTA
TGCTGGTCTTTTGGAAAAAAAATGGACATCTGTTATTAGATTACAAAAAAAGGTAATGGAATTAGAATCA
AAACTAAATGAAGCAAAAGAAGAATTTACGTCGGGTGGTCCTCTTGGTCAGAAACGGGACCCAAAAGAAT
GGATTCCCCGTCCACCTGAGAAATACGCATTGAGTGGTCATAGGAGTCCAGTTACTCGAGTCATTTTCCA
TCCTGTGTTCAGTGTTATGGTCTCTGCTTCAGAGGATGCTACAATTAAGGTGTGGGATTATGAGACTGGA
GATTTTGAGCGAACTCTCAAGGGCCATACAGACTCTGTACAGGACATTTCCTTTGACCACAGTGGCAAGC
TTCTGGCTTCCTGTTCAGCAGATATGACGATTAAATTATGGGATTTTCAGGGTTTTGAATGCATCAGAAC
CATGCACGGTCACGATCACAATGTCTCTTCAGTAGCCATCATGCCTAATGGAGATCATATAGTGTCTGCC
TCAAGGGATAAAACTATAAAGATGTGGGAAGTGCAAACTGGCTACTGTGTGAAGACATTCACAGGACACA
GAGAATGGGTACGTATGGTGCGGCCAAATCAGGATGGCACTCTGATAGCCAGCTGTTCCAATGACCAGAC
TGTGCGTGTGTGGGTTGTAGCAACAAAGGAATGCAAGGCTGAGCTCCGAGAACATGAACATGTGGTGGAA
TGCATTTCCTGGGCTCCAGAAAGTTCATATTCTTCCATCTCTGAAGCAACAGGATCTGAGACTAAAAAAA
GTGGCAAGCCTGGACCTTTCTTGCTATCTGGTTCCAGAGACAAAACTATTAAGATGTGGGACGTCAGTAC
TGGCATGTGCCTTATGACTCTTGTGGGTCATGATAACTGGGTACGTGGAGTTCTGTTCCATTCTGGGGGG
AAGTTTATTTTGAGTTGTGCTGATGACAAGACCCTCCGTGTATGGGATTATAAGAACAAGCGATGCATGA
AGACCCTCAATGCGCATGAACACTTTGTTACCTCCTTGGATTTCCATAAGACGGCACCCTATGTGGTTAC
TGGCAGTGTAGATCAAACAGTAAAGGTGTGGGAGTGCCGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206439 protein sequence
Red=Cloning site Green=Tags(s)

MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIRLQKKVMELES
KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETG
DFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSA
SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVE
CISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG
KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC026141
ORF Size 1230 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC026141, AAH26141
RefSeq Size 1935 bp
RefSeq ORF 1232 bp
Locus ID 18472
Cytogenetics 11 45.76 cM
MW 46.7 kDa
Gene Summary Positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus end. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the peripheral transport of microtubule fragments and the coupling of the nucleus and centrosome. Required during brain development for the proliferation of neuronal precursors and the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Neuronal migration involves a process called nucleokinesis, whereby migrating cells extend an anterior process into which the nucleus subsequently translocates. During nucleokinesis dynein at the nuclear surface may translocate the nucleus towards the centrosome by exerting force on centrosomal microtubules. Also required for proper activation of Rho GTPases and actin polymerization at the leading edge of locomoting cerebellar neurons and postmigratory hippocampal neurons in response to calcium influx triggered via NMDA receptors. May also play a role in other forms of cell locomotion including the migration of fibroblasts during wound healing. Non-catalytic subunit of an acetylhydrolase complex which inactivates platelet-activating factor (PAF) by removing the acetyl group at the SN-2 position. Required for dynein recruitment to microtubule plus ends and BICD2-bound cargos (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.