Cth (NM_145953) Mouse Tagged ORF Clone

CAT#: MR206244

Cth (Myc-DDK-tagged) - Mouse cystathionase (cystathionine gamma-lyase) (Cth)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cth (NM_145953) Mouse Tagged ORF Clone
Symbol Cth
Synonyms 0610010I13Rik; AI314617; BC019483; CSE; Cys3
Vector pCMV6-Entry
Sequence Data
>MR206244 representing NM_145953
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAAGGACGCCTCTTTGAGCGGCTTCCTGCCTAGTTTCCAGCATTTCGCCACTCAGGCCATCCACG
TGGGACAAGAGCCTGAGCAATGGAATTCTCGTGCCGTGGTGCTGCCCATTTCGTTGGCCACCACATTTAA
GCAGGACTTCCCGGGCCAGTCCTCGGGTTTTGAATACAGCCGCTCTGGAAATCCAACAAGGAATTGCTTG
GAAAAAGCAGTGGCTGCGTTGGATGGGGCAAAGCACAGTTTGGCCTTTGCATCGGGTCTTGCTGCCACCA
TTACGATTACCCATCTTTTAAAAGCAGGAGATGAAATCATTTGCATGGATGAAGTGTATGGAGGCACCAA
CAGGTACTTCAGGAGGGTGGCATCTGAATTTGGACTGAAGATTTCTTTTGTAGATTGTTCCAAAACCAAA
TTGCTAGAGGCAGCGATTACACCACAAACCAAGCTTGTTTGGATCGAAACACCCACAAACCCAACTTTGA
AGTTGGCTGACATTGGAGCCTGCGCACAAATTGTCCACAAACGTGGAGACATCATTTTGGTTGTAGATAA
CACCTTCATGTCTGCATATTTCCAGAGACCTTTGGCTCTGGGTGCTGATATTTGTATGTGTTCTGCCACA
AAATACATGAATGGCCACAGCGATGTTGTCATGGGTTTAGTGTCTGTTAATTCTGATGACCTCAATAGTC
GGCTTCGTTTCCTGCAGAATTCACTAGGAGCAGTTCCTTCTCCTTTTGATTGTTACCTCTGCTGCCGAGG
CCTGAAGACACTGCAGGTCCGGATGGAGAAACATTTCAAGAATGGGATGGCGGTGGCTCGTTTCCTGGAG
ACCAATCCCCGGGTAGAAAAGGTTGTTTATCCTGGGCTACCCTCTCACCCTCAGCATGAGCTGGCCAAAC
GCCAGTGCTCGGGCTGCCCAGGGATGGTCAGTTTCTACATCAAGGGTGCTCTGCAGCATGCTAAGGCCTT
CCTCAAAAATCTAAAGCTGTTTACTCTGGCAGAGAGCCTGGGAGGATATGAGAGTCTGGCTGAGCTTCCA
GCAATCATGACCCATGCCTCTGTGCCTGAGAAGGACAGAGCTACCCTCGGGATCAATGACACACTGATAC
GACTTTCTGTGGGCCTAGAGGATGAACAGGACCTTCTTGAAGACCTGGATCGAGCTTTGAAGGCAGCGCA
CCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR206244 representing NM_145953
Red=Cloning site Green=Tags(s)

MQKDASLSGFLPSFQHFATQAIHVGQEPEQWNSRAVVLPISLATTFKQDFPGQSSGFEYSRSGNPTRNCL
EKAVAALDGAKHSLAFASGLAATITITHLLKAGDEIICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTK
LLEAAITPQTKLVWIETPTNPTLKLADIGACAQIVHKRGDIILVVDNTFMSAYFQRPLALGADICMCSAT
KYMNGHSDVVMGLVSVNSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLE
TNPRVEKVVYPGLPSHPQHELAKRQCSGCPGMVSFYIKGALQHAKAFLKNLKLFTLAESLGGYESLAELP
AIMTHASVPEKDRATLGINDTLIRLSVGLEDEQDLLEDLDRALKAAHP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_145953
ORF Size 1194 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_145953.1, NM_145953.2, NP_666065
RefSeq Size 1815
RefSeq ORF 1197
Locus ID 107869
Cytogenetics 3|3 H4
MW 44 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)