Kcne2 (NM_134110) Mouse Tagged ORF Clone
CAT#: MR200617
- TrueORF®
Kcne2 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 2 (Kcne2)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_134110" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Kcne2 |
Synonyms | 2200002I16Rik; AW048273; MiRP1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200617 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCACATTAGCCAATTTGACCCAGACACTGGAGGATGCCTTCAAAAAGATTTTTATTACTTATATGG ACAGCTGGAGGAGGAACACGACAGCCGAGGAGCAGGCACTCCAGGCCAGAGTGGATGCCGAGAACTTCTA CTACGTCATCCTGTACCTCATGGTGATGATCGGCATGTTCTCGTTCATCGTGGTGGCCATCCTGGTGAGC ACGGTGAAGTCGAAGCGGCGAGAGCACTCCCAGCACCCGTACCACCAGTACATCGTGGAAGATTGGCAGG AAAAGTACAAAAGTCAGATCCTGCATCTGGAAGACTCCAAGGCCACCATCCATGAGAACATGGGGGCGAC GGGGTTCACAGTGTCACCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200617 protein sequence
Red=Cloning site Green=Tags(s) MATLANLTQTLEDAFKKIFITYMDSWRRNTTAEEQALQARVDAENFYYVILYLMVMIGMFSFIVVAILVS TVKSKRREHSQHPYHQYIVEDWQEKYKSQILHLEDSKATIHENMGATGFTVSP myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_134110 |
ORF Size | 372 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_134110.1, NM_134110.2, NM_134110.3, NP_598871.1 |
RefSeq Size | 1707 bp |
RefSeq ORF | 372 bp |
Locus ID | 246133 |
UniProt ID | Q9D808 |
Cytogenetics | 16 C4 |
MW | 14.4 kDa |
Gene Summary | Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1. Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr). May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current (By similarity). Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC204104 | Kcne2 (untagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 2 (Kcne2), (10ug) |
USD 150.00 |
|
MG200617 | Kcne2 (tGFP-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 2 (Kcne2) |
USD 350.00 |
|
MR200617L3 | Lenti ORF clone of Kcne2 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 2 (Kcne2) |
USD 450.00 |
|
MR200617L4 | Lenti ORF clone of Kcne2 (mGFP-tagged) - Mouse potassium voltage-gated channel, Isk-related subfamily, gene 2 (Kcne2) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review