Cdc42se2 (NM_178626) Mouse Tagged ORF Clone

CAT#: MR200176

Cdc42se2 (Myc-DDK-tagged) - Mouse CDC42 small effector 2 (Cdc42se2)

Product Images

Circular map for MR200176

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cdc42se2
• Synonyms: 2810404F18Rik; AA408783; AA536669; SPEC2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200176 representing NM_178626
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTGAATTCTGGTTGTGTTTCAACTGCTGTATTGCAGAGCAGCCTCAGCCTAAGAGGCGACGACGGA
  TTGACCGAAGTATGATCGGAGAGCCAACCAACTTTGTGCACACAGCTCACGTAGGATCCGGAGACCTATT
  TAGTGGGATGAACTCAGTCAGCTCCATTCAGAACCAGATGCAGTCCAAGGGAGGCTATGGAGGTGGAATG
  CCTGCCAACGTGCAGATGCAGCTCGTGGACACCAAGGCAGGA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200176 representing NM_178626
  Red=Cloning site Green=Tags(s)
  
  MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGM
  PANVQMQLVDTKAG
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_178626
• ORF Size: 252 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_178626.3, NP_848741.1
• RefSeq Size: 3138 bp
• RefSeq ORF: 255 bp
• Locus ID: 72729
• UniProt ID: Q8BGH7
• Cytogenetics: 11 B1.3
• MW: 9.7 kDa
• Gene Summary: Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages (By similarity).[UniProtKB/Swiss-Prot Function]