RAB22A Rabbit Polyclonal Antibody

CAT#: TA344771

Rabbit Polyclonal Anti-RAB22A Antibody - middle region

Product Images

WB Suggested Anti-RAB22A Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysateRAB22A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  Lanes : Murin JAWS-II cells Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit-FITC Secondary Antibody Dilution : 1:1500 Gene Name : Blue: Nucleus Green: Rab22a Submitted by : RAB22A

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human, Murine
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB22A antibody: synthetic peptide directed towards the middle region of human RAB22A. Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: RAB22A, member RAS oncogene family
• Database Link:
  NP_065724
  Entrez Gene 57403 Human
  UniProt ID Q9UL26
• Background: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
• Synonyms: MGC16770
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis