TRIM58 Rabbit Polyclonal Antibody

CAT#: TA344502

Rabbit Polyclonal Anti-TRIM58 Antibody - middle region

Product Images

WB Suggested Anti-TRIM58 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM58 antibody: synthetic peptide directed towards the middle region of human TRIM58. Synthetic peptide located within the following region: FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: tripartite motif containing 58
• Database Link:
  NP_056246
  Entrez Gene 25893 Human
  UniProt ID Q8NG06
• Background: The specific function of the protein remains unknown.
• Synonyms: BIA2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome