SLC25A6 Rabbit Polyclonal Antibody

CAT#: TA344297

Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 (SLC25A6), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "SLC25A6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 33 kDa
Gene Name solute carrier family 25 member 6
Background SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
Synonyms 2; 3; AAC3; ANT; ANT 2; ANT 3; ANT3; ANT3Y
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%; Goat: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Calcium signaling pathway, Huntington's disease, Parkinson's disease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.