RALYL Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of RALY RNA binding protein-like (RALYL), transcript variant 3
USD 436.00
Recombinant protein of human RALY RNA binding protein-like (RALYL), transcript variant 3, 20 µg
USD 867.00
Other products for "RALYL"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RALYL antibody: synthetic peptide directed towards the C terminal of human RALYL. Synthetic peptide located within the following region: AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 32 kDa |
Gene Name | RALY RNA binding protein-like |
Database Link | |
Background | RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown. |
Synonyms | HNRPCL3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 86%; Mouse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.