CPSF1 Rabbit Polyclonal Antibody

CAT#: TA343791

Rabbit Polyclonal Anti-CPSF1 Antibody

Product Images

WB Suggested Anti-CPSF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPSF1 antibody: synthetic peptide directed towards the middle region of human CPSF1. Synthetic peptide located within the following region: GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 161 kDa
• Gene Name: cleavage and polyadenylation specific factor 1
• Database Link:
  NP_037423
  Entrez Gene 29894 Human
  UniProt ID Q10570
• Background: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.
• Synonyms: cl.18; CPSF160; HSU37012; P
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 79%; Rat: 77%