Coronin 1a (CORO1A) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human coronin, actin binding protein, 1A (CORO1A), 20 µg
USD 867.00
Other products for "Coronin 1a"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CORO1A antibody: synthetic peptide directed towards the C terminal of human CORO1A. Synthetic peptide located within the following region: ELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLD |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | coronin 1A |
Database Link | |
Background | CORO1A is a novel actin-binding protein with a WD repeat and a leucine zipper motif. CORO1A forms homodimers, that the association is mediated by the leucine zipper structure in the C-terminal region, and that it plays a role in the cross-linking of F-actin in the cell. The leukocyte plasma membrane associates with the actin cytoskeleton through CORO1A.Downregulation of CORO1A gene transcription restricts entry/survival of mycobacteria within macrophages |
Synonyms | CLABP; CLIPINA; HCORO1; IMD8; p57; TACO |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Bovine: 93%; Pig: 90%; Rat: 83%; Rabbit: 79%; Mouse: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.