AKAP9 Rabbit Polyclonal Antibody

CAT#: TA343561

Rabbit Polyclonal Anti-AKAP9 Antibody

Product Images

WB Suggested Anti-AKAP9 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 12500; Positive Control: Jurkat cell lysate; There is BioGPS gene expression data showing that AKAP9 is expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKAP9 antibody: synthetic peptide directed towards the N terminal of human AKAP9. Synthetic peptide located within the following region: MEDEERQKKLEAGKAKLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHDVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: A-kinase anchoring protein 9
• Database Link:
  NP_005742
  Entrez Gene 10142 Human
  UniProt ID Q99996
• Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP9 is a member of the AKAP family. Alternate splicing of this gene results in many isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways.
• Synonyms: AKAP-9; AKAP350; AKAP450; CG-NAP; HYPERION; LQT11; MU-RMS-40.16A; PPP1R45; PRKA9; YOTIAO
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome