CNTF Receptor alpha (CNTFR) Rabbit Polyclonal Antibody

CAT#: TA342812

Reviews ()
Write a review

Rabbit Polyclonal Anti-CNTFR Antibody


 Product Datasheet for 'TA342812'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Clone Name Polyclonal
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CNTFR antibody: synthetic peptide directed towards the C terminal of human CNTFR. Synthetic peptide located within the following region: VAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 41 kDa
Gene Name ciliary neurotrophic factor receptor
Background This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified.
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Other products for "CNTFR"
Frequently bought together (2)
Transient overexpression lysate of ciliary neurotrophic factor receptor (CNTFR), transcript variant 2
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
40% off proteins and antibodies
68 Mouse Clones