RPA70 (RPA1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human replication protein A1, 70kDa (RPA1), 20 µg
USD 867.00
Other products for "RPA70"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 68 kDa |
Gene Name | replication protein A1 |
Database Link | |
Background | RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. RPA1 binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing |
Synonyms | HSSB; MST075; REPA1; RF-A; RP-A; RPA70 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Yeast: 93%; Guinea pig: 93%; Zebrafish: 92% |
Reference Data | |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | DNA replication, Homologous recombination, Mismatch repair, Nucleotide excision repair |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.