NRG1 Rabbit Polyclonal Antibody

CAT#: TA341924

Rabbit Polyclonal Anti-NRG1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of neuregulin 1 (NRG1), transcript variant HRG-beta1
    • 100 ug

USD 665.00

Other products for "NRG1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 70 kDa
Gene Name neuregulin 1
Background The protein encoded byThis gene is a membrane glycoprotein that that mediates cell-cell signaling and plays a critical role inThe growth and development of multiple organ systems. An extraordinary variety of different isoforms are produced fromThis gene through alternative promoter usage and splicing.These isoforms are expressed in a tissue-specific manner and differ significantly inTheir structure, and are classified as types I, II, III, IV, V and VI. Dysregulation ofThis gene has been linked to diseases such as cancer, schizophrenia, and bipolar disorder (BPD). [provided by RefSeq, Jun 2014]
Synonyms ARIA; GGF; GGF2; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; NRG1-IT2; SMDF
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein, Transcription Factors, Transmembrane
Protein Pathways ErbB signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.