RAB40A Rabbit Polyclonal Antibody

CAT#: TA340254

Rabbit Polyclonal Anti-RAB40A Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of RAB40A, member RAS oncogene family (RAB40A)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human RAB40A, member RAS oncogene family (RAB40A), 20 µg
    • 20 ug

USD 867.00

Other products for "RAB40A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAB40A antibody: synthetic peptide directed towards the middle region of human RAB40A. Synthetic peptide located within the following region: RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 31 kDa
Gene Name RAB40A, member RAS oncogene family
Background RAB40A belongs to the small GTPase superfamily, Rab family. It contains 1 SOCS box domain. RAB40A may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Synonyms RAR2; RAR2A
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 85%; Dog: 79%; Goat: 79%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.