Sprouty 1 (SPRY1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 1
USD 436.00
Purified recombinant protein of Homo sapiens sprouty homolog 1, antagonist of FGF signaling (Drosophila) (SPRY1), transcript variant 2, 20 µg
USD 867.00
Other products for "Sprouty 1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SPRY1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRY1. Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | sprouty RTK signaling antagonist 1 |
Database Link | |
Background | SPRY1 belongs to the sprouty family. It contains 1 SPR (sprouty) domain. SPRY1 may function as an antagonist of fibroblast growth factor (FGF) pathways and may negatively modulate respiratory organogenesis. |
Synonyms | hSPRY1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Jak-STAT signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.