ADAM15 Rabbit Polyclonal Antibody

CAT#: TA339378

Rabbit Polyclonal Anti-ADAM15 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of ADAM metallopeptidase domain 15 (ADAM15), transcript variant 2
    • 100 ug

USD 436.00

Other products for "ADAM15"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ADAM15 antibody: synthetic peptide directed towards the middle region of human ADAM15. Synthetic peptide located within the following region: QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 70 kDa
Gene Name ADAM metallopeptidase domain 15
Background The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Synonyms MDC15
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 86%; Pig: 85%; Horse: 85%; Dog: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.