TAF3 Rabbit Polyclonal Antibody

CAT#: TA339161

Rabbit Polyclonal Anti-TAF3

Product Images

WB Suggested Anti-TAF3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAF3 antibody: synthetic peptide directed towards the middle region of human TAF3. Synthetic peptide located within the following region: RDREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 103 kDa
• Gene Name: TATA-box binding protein associated factor 3
• Database Link:
  NP_114129
  Entrez Gene 83860 Human
  UniProt ID Q5VWG9
• Background: Transcription factor TFIID is one of the general factors required for accurate and regulated initiation by RNA polymerase II. TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. TAF3 is required in complex with TBPL2 for the differentiation of myoblasts into myocytes. The complex replaces TFIID at specific promoters at an early stage in the differentiation process.
• Synonyms: TAF140; TAFII-140; TAFII140
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Zebrafish: 85%; Dog: 79%; Yeast: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome