CRYZL1 Rabbit Polyclonal Antibody

CAT#: TA338954

Rabbit Polyclonal Anti-CRYZL1 Antibody

Product Images

Host: Rabbit; Target Name: CRYZL1; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0 ug/ml.CRYZL1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CRYZL1 antibody is: synthetic peptide directed towards the C-terminal region of Human CRYZL1. Synthetic peptide located within the following region: LLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: crystallin zeta like 1
• Database Link:
  NP_665857
  Entrez Gene 9946 Human
  UniProt ID O95825
• Background: This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but their full-length nature has not been completely determined. [provided by RefSeq, Jul 2008]
• Synonyms: 4P11; QOH-1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome