C1orf177 (LEXM) Rabbit Polyclonal Antibody

CAT#: TA338884

Rabbit Polyclonal Anti-C1orf177 Antibody


 Product Datasheet for 'TA338884'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-C1orf177 antibody: synthetic peptide directed towards the middle region of human C1orf177. Synthetic peptide located within the following region: YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml
Purification Protein A purified
Predicted Protein Size 47 kDa
Gene Name lymphocyte expansion molecule
Background The specific function of C1orf177 is not yet known.
Synonyms C1orf177; LEM
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Horse: 86%; Bovine: 86%; Dog: 79%; Rat: 79%; Mouse: 79%
Reference Data
Other products for "LEXM"
Frequently bought together (2)
Transient overexpression lysate of chromosome 1 open reading frame 177 (C1orf177), transcript variant 1
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones